KEGG   Lachancea thermotolerans: KLTH0D09504g
Entry
KLTH0D09504g      CDS       T01117                                 
Name
(RefSeq) KLTH0D09504p
  KO
K12575  kinetochore protein SLK19
Organism
lth  Lachancea thermotolerans
Pathway
lth04111  Cell cycle - yeast
lth04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:lth00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    KLTH0D09504g
   04113 Meiosis - yeast
    KLTH0D09504g
SSDB
Motif
Pfam: Fungal_TACC Crescentin BRE1 Fez1 DUF3618 SAP
Other DBs
NCBI-GeneID: 8295361
NCBI-ProteinID: XP_002553123
UniProt: C5DGZ3
LinkDB
Position
D:783223..785379
AA seq 718 aa
MGDSNIGSFSTPLKNGISRSVELRVPNSERPYPKGVDSPGKPANDDRALRIQKNNENASQ
LRSSPWKRAKLDKFSSRSHPVSSPAVIEMLDRNVSGPHGSLRDSQALEIQDEISEAISSA
VREVSGSDSSNHDNQHRTSLINDLLSPRRDGTPDHIPDADLANLGKLTPPKNYMHNTESS
IIQNLQSCFRDELGKFEQYLKAKNEQADEYRRRTVDCFEKIKQLEEALDEQKLTYSSLLG
EYEMLRASQSVRDDQWQTQNREIEKLSTEKTSLEERVSRLKLRLSEARNEMKMINQNSQI
LQEKFQTQIQQNERLQNQVSELEDSENQLRVHIENTTNSKKRVEEEIERTRAELALLTEG
KFKTQSENEDLKLSVSKAQTLLAEKTKFIEELQANLRASHDTKQKSTIELEQRINDLTLE
KNELVRELEDMSTLRSKIEESENEIQSVKTELDRTQVALQHLKEEHSELREHCRSLEAEL
KTSHQKLETANDQLAIKSAEVVELGHDVKELRQGKSHLEDSLKLRDASISEWNSKYEEKC
AENNKLSIEIESFQFKNGNLETEHLVELEQLHQQMTSLQETLKSNSERIKELTEENSSLK
DQLEVRELPQPQQGPLVDPEQVEELHAKIQSLEQQLREKEAEAGKRLQLLAEDLYIQYSS
KHEQKVKMLKKGYESKYQDKLERLGLENSGLKDELMQLNDTLKAEREEKHNLVKLLNK
NT seq 2157 nt   +upstreamnt  +downstreamnt
atgggcgactctaacataggaagcttcagcacgccactaaagaatgggataagtagatct
gtggagttacgagtgccaaattcagaaaggccatatcccaaaggcgtagattcacctggt
aaacccgccaatgatgatcgagccttgaggatacaaaaaaacaatgagaacgcctcgcag
ctgcgctcatcaccctggaagagagcaaagcttgacaagttctcttcgcgctcgcatccc
gtttcctcgcctgctgtgatcgaaatgttggatcgaaatgtttccgggccgcatggatca
ctgcgagacagtcaagcattggaaatacaggatgagatatcagaagccatcagcagcgct
gtcagagaagtgtctggtagtgactcgtcaaatcacgataatcagcatcgcacctcgcta
atcaatgacctgctatccccaaggcgggatggcacgcctgaccacattccagatgctgac
ctcgcaaacttaggcaagctgacacctcccaagaactacatgcataacactgagagtagc
atcatccagaatctacaaagctgctttcgagatgagctcggcaagtttgagcagtaccta
aaagccaaaaacgaacaggcagatgagtaccgccgtcgtactgtagactgcttcgagaag
atcaagcaattggaagaggcactcgatgagcagaaacttacttactcctctcttttgggc
gagtatgaaatgctcagagcctctcaaagtgtccgcgacgatcaatggcaaacccaaaac
cgagaaattgaaaagctctctacagaaaaaacgagcctcgaagaacgcgtttcccggttg
aagctgcggctgtctgaggcgcggaatgaaatgaagatgataaaccaaaattcgcagata
cttcaagaaaagttccaaacacagattcagcaaaatgagaggcttcaaaaccaagtttca
gagcttgaagacagtgaaaaccaacttcgggtgcatattgaaaatactactaattctaaa
aagcgagttgaggaggaaatcgaaaggacaagggctgagcttgctctattaacagaaggc
aaattcaagacgcagtcggaaaacgaagatttaaagctttcagtctccaaggctcagact
ttgctggcagaaaaaacaaagttcattgaagagcttcaggcaaatttaagagcttctcat
gacacgaagcagaaatcaactatagagcttgaacaacgcataaacgacctaactctcgag
aaaaatgaattagtaagggaactggaggacatgagcactttaagatcaaaaattgaagaa
agtgaaaacgagatccagtcagtgaaaactgagcttgaccgaacacaagttgctcttcaa
catcttaaggaggaacattcagaactccgcgagcactgccgatctttggaagccgaactc
aaaacctctcatcaaaaactggaaacagcaaacgatcagctggctataaaatcggctgag
gtcgtggagcttggccatgatgttaaagagctgcgacaagggaaatcacacctcgaagat
tctctcaagcttcgtgacgcttcaatttcggaatggaattctaagtacgaagagaagtgt
gccgagaacaacaagctatctatcgaaattgaaagtttccagttcaagaacggtaattta
gagacagagcaccttgttgagctagaacagcttcatcagcaaatgacctcgcttcaagaa
actctaaaatcgaactctgagcgtataaaggagctaactgaagagaactcatctctcaaa
gaccaattagaggttcgagagcttcctcaaccgcagcagggacctcttgttgaccctgag
caagttgaagagttacatgctaaaatccaaagcttagagcaacaacttcgggagaaggag
gcggaagcgggtaaaaggcttcaattgctagcggaagatctctacatccagtactcctcg
aagcacgaacagaaggtcaaaatgcttaaaaaaggctacgaatcaaagtatcaagacaaa
ctcgaaaggctagggctcgaaaactcaggcttgaaagacgagttaatgcaactcaatgat
acactcaaggctgaaagagaagaaaagcataacttagtgaagctgttaaataagtag

DBGET integrated database retrieval system