KEGG   Lipotes vexillifer (Yangtze River dolphin): 103075872
Entry
103075872         CDS       T03090                                 
Symbol
MRAP
Name
(RefSeq) melanocortin 2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04927  Cortisol synthesis and secretion
lve04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:lve00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    103075872 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103075872 (MRAP)
SSDB
Motif
Pfam: MRAP AIMP2_LysRS_bd
Other DBs
NCBI-GeneID: 103075872
NCBI-ProteinID: XP_007447490
UniProt: A0A340WKE9
LinkDB
Position
Un
AA seq 186 aa
MANRTNASTAYYSYEYYLDYLDLIPVDEKKLKANKHSIVIAFWVSLAAFVVFLFLLLLSM
SWPASPQTRKHHPTCPWSLGLNLPFCVWKQPQHHGAPQGTPSPLPSSVEEPGGRASGPVQ
QLQQESPSTSAPFHSPGPPCSPLRTGPRWGPARHQLTSGTSSPVSLPCRQNLSMVEPTTQ
TRAIAE
NT seq 561 nt   +upstreamnt  +downstreamnt
atggccaaccggaccaatgcctctaccgcatactacagctacgaatactacctggattac
ttggacctcattcccgtggatgagaagaagctgaaagccaacaaacattcgatcgtcatt
gccttctgggtgagcctggcagctttcgtggtcttcctgttcctgctgctgctgtccatg
tcctggccagcctcaccgcagacgaggaaacaccacccaacgtgcccctggagtctcggc
ctcaacctccccttctgtgtctggaagcaaccccaacaccacggggccccccaggggacc
ccgtcgcctctaccgagctcggtcgaggaaccaggtggcagagcgtcgggccccgtccag
cagctgcagcaggagagtccctccacctcggcccccttccactccccagggccaccctgc
tctcctctgagaactggccctcggtggggacccgcacggcaccagctgacgtcaggaact
tcaagcccagtgagcctcccctgcagacagaacctctcgatggtagaaccaacaacccaa
accagggccattgctgagtga

DBGET integrated database retrieval system