KEGG   Lipotes vexillifer (Yangtze River dolphin): 103084995
Entry
103084995         CDS       T03090                                 
Symbol
TNFRSF8
Name
(RefSeq) TNF receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103084995 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:lve04050]
    103084995 (TNFRSF8)
   04090 CD molecules [BR:lve04090]
    103084995 (TNFRSF8)
Cytokine receptors [BR:lve04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   103084995 (TNFRSF8)
CD molecules [BR:lve04090]
 Proteins
  103084995 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 103084995
NCBI-ProteinID: XP_007463250
UniProt: A0A340XVT2
LinkDB
Position
Un
AA seq 487 aa
MFCGTSVINSCARCLPHSVCPTGMVVKFQGTAQRNTVCEPPSPGASPNCSASPQDCKAPA
SSTIPQAKPTLTSPASSDARITLLGGGTPLTPEDASRITTHSSSSVGKLNPDPGLTLQQP
CPQGSADCRKQCDPDYYLDRDGRCTACVSCSGDHLVEKTPCMWNSSRVCECRPGMFCATS
ASNSCARCVIRPICPPGMVTRLQDTAERDTTHEPPPPGTHSNCSTNAEDSGVPASPTPSL
ISLADSLTGKERGGDVTHVRGRASVSASTPISSSTGKPTLVSGPVLFWVILTLVVVVSFG
SFLLCHRRGCRKWMGQKLHLCYPVQTFQPKLEPVDSRPGRNPILIRRVSVAEPGLEEQGL
MSPPAVETCPNLESLQLLEANPASSPSTSMDLPEPRGTAEHTNNRIENIYIMKADTVIVG
TVKAKVPEGQGPVGPAGPEFEKDLEVDHAPHYPEQETEPLAGSCGDVMFSVEEEGKEDPL
PTTASGK
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgttctgtggcacatcagtcatcaactcctgtgcccgctgcctccctcactccgtctgc
ccaacagggatggttgtcaagttccagggcacagcgcagaggaacactgtctgtgagccg
ccttccccaggggccagccccaactgcagcgccagcccgcaggactgcaaggcccctgcc
agcagcaccatcccccaggccaagcccaccctgacctctccagcaagctctgatgccagg
atcacacttcttggagggggcacccccctcaccccagaagatgcttctagaatcactacc
cactctagctcctccgtggggaagctcaatccagatccagggctgaccctgcaacagcca
tgccctcaggggtctgccgactgcaggaagcagtgtgaccctgactactacctggacagg
gacggtcgctgcacggcctgtgtgagctgttcaggagaccacctcgtggagaagacacct
tgcatgtggaactcctcccgcgtctgcgagtgtcgacctggcatgttctgtgccacatca
gcctccaactcctgtgcccgctgcgtcatccgccccatctgcccaccagggatggtcacc
aggctccaggatacggctgagagggacaccacccatgagccacctcccccggggacccac
tctaactgcagcaccaacgcagaggacagcggggtgcccgccagccccaccccctccctg
atctccctggccgactccctgactggtaaggagcgtggaggggacgtcacccacgtgcgg
ggacgcgcctctgtctcagccagcactcctatatcctcctccacagggaagcccactctg
gtttcaggacctgtgctcttctgggtgatcttgacactggtggtggtcgtcagctttggc
tcctttctcctgtgccaccggaggggctgcaggaagtggatggggcagaagctccacctg
tgctacccagtccagaccttccagcccaagctggagcctgtggattccaggcccgggagg
aacccaatactgatcaggagggtatcggtggcagagccgggccttgaggagcaggggtta
atgagccccccagctgtggagacctgccccaacctggagagcctgcagctgctggaggcc
aacccagccagcagcccctccacctccatggaccttcctgagccccgagggaccgcggag
cacaccaacaacaggattgagaacatctacatcatgaaggccgacaccgtgattgtgggg
accgtgaaggccaaggtgcctgagggccagggcccggtggggccggcagggcccgagttc
gagaaggatctggaggtggaccatgccccccactacccagagcaggagacggaaccactg
gcgggcagctgtggggacgttatgttctcggtggaggaggaagggaaggaggaccccttg
cccacgaccgcctctgggaaatga

DBGET integrated database retrieval system