Leptonychotes weddellii (Weddell seal): 102735378 Help Entry 102735378         CDS       T08708                                  Symbol GHRH Name (RefSeq) somatoliberin   KO K05260   growth hormone-releasing hormone Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww04080   Neuroactive ligand-receptor interaction lww04081   Hormone signaling lww04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:lww00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     102735378 (GHRH)    04081 Hormone signaling     102735378 (GHRH)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     102735378 (GHRH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lww04052]     102735378 (GHRH) Cytokines and neuropeptides [BR:lww04052]  Neuropeptides   GPCR binding    102735378 (GHRH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_2 Motif Other DBs NCBI-GeneID:  102735378 NCBI-ProteinID:  XP_006733707 UniProt:  A0A2U3XQH5 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MLLWVFFLVILTLSSGSHSFAPSLPLRIPRYADAIFTNSYRKVLAQLSARKLLQDIMSRQ QGMRSQEQGAEVRLGRQVDGMWAGPKQTALESVLAALLQKHRYSQG NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgctgctttgggtgttcttcctggtgatcctcaccctcagcagtggctctcactctttc gcaccatccctgcccctcagaatccctcggtatgcagacgccatcttcaccaacagctac cggaaggtgctggcccagctgtctgcccgcaagctactgcaggacatcatgagccgccag caaggaatgagaagccaggagcaaggagcagaggtacggcttggccgtcaggtggacggt atgtgggcaggcccaaagcagacggcactggagagcgtcctggcagccctgttgcagaag cacaggtattcccaaggatga

DBGET integrated database retrieval system