KEGG   Martelella sp. AD-3: AZF01_18225
Entry
AZF01_18225       CDS       T04332                                 

Definition
(GenBank) benzene 1,2-dioxygenase
  KO
K15750  biphenyl 2,3-dioxygenase subunit beta [EC:1.14.12.18]
Organism
maad  Martelella sp. AD-3
Pathway
maad00621  Dioxin degradation
maad01100  Metabolic pathways
maad01120  Microbial metabolism in diverse environments
maad01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:maad00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    AZF01_18225
Enzymes [BR:maad01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.18  biphenyl 2,3-dioxygenase
     AZF01_18225
SSDB
Motif
Pfam: Ring_hydroxyl_B
Other DBs
NCBI-ProteinID: AMM86045
UniProt: A0A127CMG9
LinkDB
Position
complement(3963083..3963640)
AA seq 185 aa
MLDDTFKAAFESKPKVVSLELQHEVEQFLYWESKLLTDRRYKEWFSLLAEDIHYWMPIRS
TKIMREVAQEYTDEQGFAHFDDNWHTMKGRIRKILSDVGWSENPASRLRYLISNVMLVPE
NENTINVISASMVYRTRQERQLDVFACERRDVLRRVETEAGFEIVRRTILIDQSTILSNN
LSFFF
NT seq 558 nt   +upstreamnt  +downstreamnt
atgctcgatgacactttcaaggctgccttcgaaagcaagcccaaggtcgtttctctggaa
cttcagcacgaagtcgaacagttcctgtattgggaatccaagcttctgacggatcgccgt
tacaaagagtggttcagtcttttggctgaggacattcactattggatgccgatccgttca
acgaaaatcatgcgcgaagtggcacaggaatatacggatgagcaaggctttgctcatttc
gacgacaactggcacacgatgaaaggccggatccgcaagatcctgtcggatgtggggtgg
tccgaaaacccggcctctcgcttgcgctatctgatcagcaacgtcatgctcgttcccgag
aatgagaacacgatcaatgtcatttcggcgtcgatggtgtacaggacgcggcaggagcgc
cagctcgacgttttcgcttgtgagcgacgggatgtcctgcgtcgggttgaaaccgaagcg
ggcttcgagattgtgcgccgcacgatcctgatcgaccagagcacaatcctgtcgaacaat
ctcagctttttcttttaa

DBGET integrated database retrieval system