KEGG   Macrococcus sp. IME1552: BHM04_03485
Entry
BHM04_03485       CDS       T05070                                 
Name
(GenBank) hypothetical protein
  KO
K21274  hexaprenyl-diphosphate synthase small subunit [EC:2.5.1.83]
Organism
macr  Macrococcus sp. IME1552
Pathway
macr00900  Terpenoid backbone biosynthesis
macr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:macr00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BHM04_03485
Enzymes [BR:macr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.83  hexaprenyl diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     BHM04_03485
SSDB
Motif
Pfam: HEPPP_synt_1 SBF2
Other DBs
NCBI-ProteinID: ATD30297
LinkDB
Position
650104..650499
AA seq 131 aa
MSFYERFLNDIDELKKRYPFFEMIPVNPEILTQTIMLDVDDQTKCAILAIDTSMRMQDLV
DDSNKDRYVLSTDLLSALFYRYLASPFQQYHYQILTDCVAKQNELKQQFSHSNDPALKEQ
IDNIFVMPFMA
NT seq 396 nt   +upstreamnt  +downstreamnt
atgagcttttatgaaagatttctaaatgatattgacgaattaaagaaacgatatcctttt
ttcgaaatgattccagttaatccggaaatattaacacagacgataatgttagatgttgat
gatcagacgaaatgtgcaatacttgcgattgacacaagtatgcgtatgcaggatttagtg
gacgatagcaataaagatagatatgtgctgtcaactgatttattaagcgctttgttctat
cgttatctagcgtctccttttcaacaatatcattatcagatacttactgactgtgtcgca
aaacagaatgaacttaagcaacaattttctcattcaaatgatcctgcattgaaagaacaa
attgataatatttttgtaatgccttttatggcttaa

DBGET integrated database retrieval system