Magnetospirillum sp. ME-1: WV31_19425 Help Entry WV31_19425        CDS       T04817                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism magn  Magnetospirillum sp. ME-1 Pathway magn01100   Metabolic pathways magn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:magn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     WV31_19425   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     WV31_19425 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 DUF5783 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  ARJ67669 UniProt:  A0A1W6CSD5 LinkDB All DBs Position complement(4212665..4212898) Genome browser AA seq 77 aa AA seqDB search MSDVAERVKKIVVEHLGVEEAKVTENASFIDDLGADSLDTVELVMAFEEEFSVEIPDDAA EKILTVKDAIDFITANS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtgacgtggctgaacgggttaagaagatcgtcgtcgagcatctgggcgtcgaagag gccaaggtgaccgagaacgcctccttcatcgatgacctgggcgccgacagcctcgacacc gtcgagctggtgatggccttcgaagaagaattctccgtcgagatccccgatgacgccgcc gagaagattctcacggtgaaggacgccatcgacttcatcacggcgaattcctaa

DBGET integrated database retrieval system