KEGG   Metarhizium robertsii: MAA_08689
Entry
MAA_08689         CDS       T03107                                 
Name
(RefSeq) Cytochrome P450 CYP55A20
  KO
K15877  fungal nitric oxide reductase [EC:1.7.1.14]
Organism
maj  Metarhizium robertsii
Pathway
maj00910  Nitrogen metabolism
maj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maj00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    MAA_08689
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:maj00199]
    MAA_08689
Enzymes [BR:maj01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.14  nitric oxide reductase [NAD(P)+, nitrous oxide-forming]
     MAA_08689
Cytochrome P450 [BR:maj00199]
 Cytochrome P450, fungi type
  CYP55 family
   MAA_08689
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 19262975
NCBI-ProteinID: XP_007824878
UniProt: E9F8U0
LinkDB
AA seq 411 aa
MEPPAEYARLRATDPVSRVELFDGSLAWLVTKYKDVTFVATDNRLSKIRTRPGFPELSAG
GKEAAKAKPTFVDMDPPEHTKHRQVTRPVHRFHCLTSPYRSMVNHFFTPEYIKSLQPYIQ
KTVDDLLDALKTKGCASGPVDLVKEFALPVPSFIIYSILGVPFEDLQFLTEQNAIRTNGS
ASAREASAASKGLLEYLEKLVDLRAAAPKDDLISKLVVEQMIPGNISKADVVQNAFLLLV
AGNATMVNMIALGVVTLFQHPTQLAELTADPSLAPAFVEELCRYHTASAMAIKRTAMTDI
EIGGKVLVKAGEGVIASNQSANRDEEIFTRPDEFDMHRKWPSQDALGFGFGEHRCIAEGL
AKAELTTVFCKISPPTINHEESTAWRGADHVITISDSVPAASQAQDFCANP
NT seq 1236 nt   +upstreamnt  +downstreamnt
atggagcctcccgccgaatatgctcgtctgcgggccactgatccggtgtcgagggttgag
ctctttgacgggagccttgcttggttagtaaccaagtacaaggatgtgacctttgtggca
acggataacaggctgtccaagattaggacgcgtccgggtttcccagagctaagtgccggt
ggcaaagaggcggcaaaggccaaaccgacgtttgtcgacatggaccccccagagcacacg
aaacacaggcaggtaactcgtccagtgcacaggttccattgtctaacaagcccctatagg
agcatggtgaaccatttcttcacccccgagtatatcaagtcgttgcagccatatatccag
aagacagtggatgatctcctcgatgcgttgaaaaccaaagggtgtgcctctgggcccgtt
gacttggtcaaggaattcgcacttccagtgccctcatttatcatctacagcattctcgga
gtcccgttcgaagaccttcagtttctcacagagcaaaatgctatccgcaccaatggcagt
gcatccgcgagagaggcatcagccgctagcaagggacttctcgagtatctcgaaaagctg
gtcgatctgcgggctgcggccccaaaggacgacctcatcagcaagctggtagtggagcaa
atgattcctggaaacatctccaaggccgatgttgttcagaatgcgttcctgcttctcgtt
gcagggaatgcgaccatggtgaatatgatagcgctcggtgtcgtgacgcttttccagcac
cctactcaacttgctgagctgacggctgatccatcacttgcacctgcatttgtggaagag
ctgtgtcgctaccacactgcctctgccatggccattaagcggacagccatgacggacatt
gaaatcgggggaaaggtacttgtcaaggcgggcgagggcgttatcgcgtcgaaccagtcg
gctaatcgagatgaagagatatttacacgaccagacgagttcgacatgcaccgcaagtgg
ccgagccaagatgcgctcggcttcggcttcggcgagcatcgatgcattgcagagggtctg
gccaaggcggagctgacgactgtcttttgtaagatttctcctccaacaattaatcatgaa
gagtctacagcgtggagaggtgctgaccatgttattaccattagcgactctgttccagca
gcttcccaagctcaagatttctgtgccaatccctga

DBGET integrated database retrieval system