KEGG   Methanogenic archaeon ISO4-H5: AR505_1066
Entry
AR505_1066        CDS       T04272                                 
Name
(GenBank) methylthiol:coenzyme M methyltransferase MtsA
  KO
K16954  methylthiol:coenzyme M methyltransferase [EC:2.1.1.251]
Organism
marc  Methanogenic archaeon ISO4-H5
Pathway
marc00920  Sulfur metabolism
marc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:marc00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    AR505_1066
Enzymes [BR:marc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.251  methylated-thiol---coenzyme M methyltransferase
     AR505_1066
SSDB
Motif
Pfam: URO-D Ntox34
Other DBs
NCBI-ProteinID: AMH94784
UniProt: A0A120MI79
LinkDB
Position
1122903..1124015
AA seq 370 aa
MASEMTPTRRALASVLGGRRDYVPPANPLAQTTKDLMEWCHASWPKAHTDYKMMADLAAA
PWEVCGIEAARPQFDISLEAEVLGCKLDWNKPDRPPVTGPAYTDPKDITWKDNFYKEGRA
AVVCQAIKELRERYCGDLPIIPVITAPFTVAGHIMGVEKLVMMTVTDPEKAHEAISAATD
FCIEYGRQQVAAGAHMLFPADPSASGDLISPETYKEFVLPYHKKFATGISAPKILHMCGH
TEKLLPLIRESHMDCFSFDAPPAWYVRQVLGNKMRCLGSLDVIDLMPNGTPQQVYDRTVE
CIRQGVDVVGTACDVSNGTSLDNLKAYVRACQETPIPDETDIDDCVRAYGRAKAKYLKSM
GDVKIEGGAF
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggcttcagaaatgacccccacgaggcgtgccctcgcatcggttctgggtggtcgcagg
gactatgtccccccggccaacccccttgcacagactacgaaagaccttatggaatggtgc
cacgcctcatggcctaaggcccataccgactacaagatgatggcagatctcgccgcggct
ccctgggaggtctgcggtatcgaggccgccagaccccagttcgatatatcgctcgaggcc
gaggtactcgggtgcaaactcgattggaacaagcccgacaggcctcctgtgaccggtccc
gcttacactgatcctaaggacataacatggaaggacaacttctacaaggaaggtagagcg
gctgtggtctgtcaggccatcaaggagctgagggaaaggtactgcggcgatcttccgatt
atccccgtcatcaccgcccccttcacggtagccgggcacatcatgggagtcgagaaactc
gtcatgatgaccgttaccgaccctgagaaggcacacgaggctatttcggccgccactgat
ttctgtatagaatatggaagacagcaggtagccgcaggcgcccacatgctcttccccgcc
gacccttcggcatccggagacctgatatcccctgagacttacaaggaattcgtgcttccc
taccacaagaagttcgccaccggaatcagcgcaccaaagattctccacatgtgcggacac
acggagaagctgctgcccctcatcagggagagtcacatggactgcttctccttcgatgca
cctccggcatggtacgtcaggcaggtgctcggcaacaagatgcgctgcctcggttctctc
gatgtcatcgacctgatgcctaacggaaccccgcagcaggtgtacgaccgcaccgtcgaa
tgcatcagacagggagtggatgtggtcggaaccgcctgcgacgtgtcgaacggtacatcc
ctcgacaacctcaaggcatacgtgagggcctgtcaggagacccccattcccgacgagacc
gacatcgacgactgcgtccgcgcatacggaagggccaaggcaaagtatctcaagtcaatg
ggagacgtcaagatcgaaggaggtgcgttctga

DBGET integrated database retrieval system