KEGG   Candidatus Micrarchaeota archaeon Mia14: Mia14_0299
Entry
Mia14_0299        CDS       T05015                                 
Name
(GenBank) 4-hydroxy-tetrahydrodipicolinate synthase
  KO
K18127  2-dehydro-3-deoxy-D-gluconate aldolase [EC:4.1.2.51]
Organism
marh  Candidatus Micrarchaeota archaeon Mia14
Pathway
marh00030  Pentose phosphate pathway
marh00052  Galactose metabolism
marh01100  Metabolic pathways
marh01120  Microbial metabolism in diverse environments
marh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:marh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mia14_0299
   00052 Galactose metabolism
    Mia14_0299
Enzymes [BR:marh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.51  2-dehydro-3-deoxy-D-gluconate aldolase
     Mia14_0299
SSDB
Motif
Pfam: DHDPS Phage_lysozyme2
Other DBs
NCBI-ProteinID: ASI13629
UniProt: A0A218NMD2
LinkDB
Position
270362..271252
AA seq 296 aa
MLYQHRKYGMVTPTVTLLRQGSIDLDAVKSLMQFLKKSGAKGAFIAGSTGNAPMLSLNEH
KEVIKQYIKYAKEEHLATFVGIGRDSIDETVAMGEYSIELGADKLVAVTPYYMKEDQKQM
HAYYSELLSKLDSEVLIYNIPSLTGNNIEAETVAKLAEENSNLIGIKSTNADFDQFQKLI
YYTDNDFLVFQGYDHLLLPSLELGASGGVCGTTNLTDIAEKLYESYNRKEPAKSIKLHKQ
LSSIYHMLEPYEFPAVYNAMFYKTIMGTEIAKEPELFGNLSKKEASLLSKKLSGLL
NT seq 891 nt   +upstreamnt  +downstreamnt
atgttgtatcagcacaggaaatatggtatggtaacgcctacggttacacttttaaggcag
ggttcaatagatttggatgcagtaaaatcactgatgcaattccttaagaaaagcggtgca
aaaggtgcattcattgcaggctctaccggaaatgccccaatgctaagcctgaacgagcac
aaggaggtaataaagcagtatatcaaatatgcaaaagaagagcatcttgcaacgtttgtc
ggaatcgggagagattcgatagacgagacagtggcaatgggggaatattcaattgaacta
ggtgcggataagcttgttgctgtaacaccctattatatgaaagaggaccagaagcagatg
cacgcatattattcagagctgttgagcaagcttgattcggaagttcttatatacaatata
ccatcacttaccggcaataatatagaagccgaaactgttgccaagcttgcggaggagaat
agcaatttgatagggataaagtcaactaatgcggattttgaccagttccagaagctgata
tattatacggacaatgactttcttgtattccaggggtacgaccatcttttgctgccttct
cttgagcttggtgcatccgggggggtatgcgggactactaatttaaccgacattgccgaa
aagttgtacgaatcatacaaccgcaaagagcctgcaaaaagcatcaagttgcacaagcag
ctgtcaagcatataccatatgcttgagccctatgagttccctgcggtgtacaatgcgatg
ttctataagacaataatgggaaccgagatagcaaaagagccagaactttttggtaactta
agcaaaaaagaggcaagcttactatcaaagaagctaagtggcttgctttga

DBGET integrated database retrieval system