KEGG   Macrococcus armenti: LAU42_05990
Entry
LAU42_05990       CDS       T07974                                 
Name
(GenBank) polyprenyl synthetase family protein
  KO
K21275  hexaprenyl-diphosphate synthase large subunit [EC:2.5.1.83]
Organism
mary  Macrococcus armenti
Pathway
mary00900  Terpenoid backbone biosynthesis
mary01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mary00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LAU42_05990
Enzymes [BR:mary01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.83  hexaprenyl diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     LAU42_05990
SSDB
Motif
Pfam: polyprenyl_synt SeqA_N
Other DBs
NCBI-ProteinID: UBH21361
LinkDB
Position
complement(1161806..1162783)
AA seq 325 aa
MIALSYKAFLNPYIIEVEKRLYECIQSDSESINKAAHHILSSGGKRVRPMFVLLSGFLND
TQKDNLIRTAVSLELVHMASLVHDDYIDNSDMRRGNTSVHIAFDKDTAIRTGHFLLARAL
QNIATINNSKFHQIFSKTILEVCFGEFDQMADRFNYPVSFTAYLRRINRKTAILIDASCH
LGALSSQLDEQSTYHIKQFGHCIGMSYQIIDDILDYTSDEATLGKPVGSDIRNGHITYPL
MAAIANLKERNDDELEVVVKQLTSTSEDEVYQYIVSQVKQYGIEPAEVLSRKYGDKAKYH
LSQLQDSNIKNYLEEIHEKMLKRVY
NT seq 978 nt   +upstreamnt  +downstreamnt
atgattgctttgagttataaagcgtttttaaacccatatatcattgaagttgaaaaaagg
ttatatgagtgtattcagagtgattctgaatcgataaacaaggcggcacaccatatatta
agttcaggaggaaaacgtgttcgtccgatgtttgtattgttaagtggttttcttaatgat
acacaaaaggataacttaattcgtactgcagtatctcttgagctcgttcatatggcaagt
ctcgttcatgatgattacatagacaatagtgatatgcgtcgtgggaatacttcggttcat
atagcttttgataaagacacagcaattcgcacaggacactttttattagcacgtgcatta
caaaatattgcaactatcaataattcgaaattccatcaaatttttagtaaaacgatactt
gaagtttgtttcggtgaattcgaccagatggcagatcgatttaattaccctgtatccttt
actgcatatttaagacgtattaatcgtaaaacagcgatactgatagacgcaagctgtcat
ttaggggctctcagctcacagcttgatgaacaatccacataccatataaaacaatttggg
cattgtattggaatgagttatcaaattattgatgatattctagattacacaagtgacgaa
gcaacacttggtaaacctgtcggtagcgatataagaaacggtcatattacgtatccgctt
atggccgctatcgctaatttgaaagagcgtaatgacgatgaacttgaagtggttgttaaa
caattaacatcgacatcagaagatgaagtgtatcaatatattgtttcgcaagttaaacaa
tatggaattgaacctgcagaagtgctgagcagaaaatatggtgataaagcgaaatatcac
ttgagtcaattacaggatagtaatattaaaaattatttagaagaaatccacgaaaaaatg
ttaaaacgtgtttattaa

DBGET integrated database retrieval system