KEGG   Macrococcus armenti: LAU42_06000
Entry
LAU42_06000       CDS       T07974                                 
Name
(GenBank) hypothetical protein
  KO
K21274  hexaprenyl-diphosphate synthase small subunit [EC:2.5.1.83]
Organism
mary  Macrococcus armenti
Pathway
mary00900  Terpenoid backbone biosynthesis
mary01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mary00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LAU42_06000
Enzymes [BR:mary01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.83  hexaprenyl diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     LAU42_06000
SSDB
Other DBs
NCBI-ProteinID: UBH21363
LinkDB
Position
complement(1163504..1163935)
AA seq 143 aa
MRYLHKIELELKRLTSRYPYFKKIEFDAEIIKLVDNLNVDENVKCAIVAIDTSMRMQDLI
NEDNKDNYVLSTDVLSALFYKYLSEPFYQHDFLVLTDCVSRINELKSIRATITDEIALHN
INKQIHYMFIQPYMNNEKVVSYE
NT seq 432 nt   +upstreamnt  +downstreamnt
atgcgttatttacataaaattgaactagaattaaaaagacttacaagtcgatatccatat
ttcaaaaaaattgaatttgatgctgaaatcattaagctcgttgataatctaaatgtcgat
gaaaatgtaaagtgtgcgattgttgccattgatacgagtatgcgtatgcaggatttgatc
aatgaagataataaagacaattatgtactatcaacggatgttttgagtgcattattttat
aagtatttatcagagccattttatcagcatgattttttagtactgacggattgtgtaagt
cgtatcaatgaattaaaatcaataagagcaacgataacagacgaaattgctttgcataat
attaataaacaaattcattatatgttcatacaaccttatatgaacaatgagaaagtggtg
tcttatgagtaa

DBGET integrated database retrieval system