Mesocricetus auratus (golden hamster): 101834855 Help Entry 101834855         CDS       T08306                                  Symbol Ghrh Name (RefSeq) somatoliberin precursor   KO K05260   growth hormone-releasing hormone Organism maua  Mesocricetus auratus (golden hamster) Pathway maua04080   Neuroactive ligand-receptor interaction maua04081   Hormone signaling maua04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:maua00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     101834855 (Ghrh)    04081 Hormone signaling     101834855 (Ghrh)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     101834855 (Ghrh)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:maua04052]     101834855 (Ghrh) Cytokines and neuropeptides [BR:maua04052]  Neuropeptides   GPCR binding    101834855 (Ghrh) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_2 Motif Other DBs NCBI-GeneID:  101834855 NCBI-ProteinID:  NP_001268519 UniProt:  Q60549 A0A1U7Q266 LinkDB All DBs AA seq 107 aa AA seqDB search MPLWVFFVILTLTNGSHCSPSPSLPFRIRRYADAIFTSSYRKVLGQLSARKLLQDIMSRQ QGERNQEQGPRVRLGRQVDSMWADHRQMSLESLLAALLQKHSRDSQG NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgccactctgggtgttctttgtaatcctcaccctcaccaatggctcccactgttcaccg tccccatcactgcccttcaggattcgtcgatatgcagatgccatctttaccagcagctac agaaaagttctgggccagctgtctgcccgcaaactgctccaggacatcatgagcaggcag cagggggagaggaaccaggaacaaggacccagggtacggcttggccgtcaggtggacagc atgtgggcagaccacaggcagatgtctctggagagcctcttggcagccctgctgcagaag cacagcagggactcccaaggatga

DBGET integrated database retrieval system