Mycobacterium avium 104: MAV_2016 Help Entry MAV_2016          CDS       T00433                                  Name (GenBank) conserved domain protein   KO K05375   MbtH protein Organism mav  Mycobacterium avium 104 Pathway mav00261   Monobactam biosynthesis mav01100   Metabolic pathways mav01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mav00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MAV_2016  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mav01008]     MAV_2016 Polyketide biosynthesis proteins [BR:mav01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MAV_2016 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ABK66567 UniProt:  A0A0H2ZXS3 LinkDB All DBs Position 2014458..2014673 Genome browser AA seq 71 aa AA seqDB search MSANPFDDDTATFVVLVNDEDQHSLWPTFAETPPGWRVVFGAAGRADCLQYVEQNWSDIR PKSLIEALAGE NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgagcgccaacccctttgacgacgacaccgcgaccttcgtggtgctggtcaacgacgag gaccagcacagcctgtggccgaccttcgccgagacgcccccgggctggcgtgtggtcttc ggtgcggccggccgcgccgactgcctgcagtacgtggagcagaattggtcggatatccgg cccaagagcctgatcgaggcgctcgccggcgagtag

DBGET integrated database retrieval system