KEGG   Metarhizium acridum: MAC_00270
Entry
MAC_00270         CDS       T03104                                 
Name
(RefSeq) Cytochrome P450 55A2
  KO
K15877  fungal nitric oxide reductase [EC:1.7.1.14]
Organism
maw  Metarhizium acridum
Pathway
maw00910  Nitrogen metabolism
maw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maw00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    MAC_00270
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:maw00199]
    MAC_00270
Enzymes [BR:maw01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.14  nitric oxide reductase [NAD(P)+, nitrous oxide-forming]
     MAC_00270
Cytochrome P450 [BR:maw00199]
 Cytochrome P450, fungi type
  CYP55 family
   MAC_00270
SSDB
Motif
Pfam: p450 HlyE
Other DBs
NCBI-GeneID: 19244581
NCBI-ProteinID: XP_007806610
UniProt: E9DRA1
LinkDB
Position
Unknown
AA seq 356 aa
MSVEPPSFPFQRASGMDPPAEYARLRATDPVSRVKLFDGSLAWLVTKYKDVTQVATDDRL
SKVRDRPGFPELSAGADLFERSMVSKFFTDEHVKNLQPFIQKTVDDLLASMKTKGCAAGP
VDLVKEFALPVPSYIIYTILGVPFSDLEYLTEQVATRSNGSGTAREASTANQELLNYIGT
LVDKRLAEPKNDLISELVVNQVSKGVIDKSDAVQIAFLLLVAGNATLVNMINLHPDQLDQ
LKSDPSRAGAFVKELCRYHTASALAMKRTAKVDVEIGGQLIKAGEGIIASNQSANRDAEI
FTDPDKFDMNRTWPAEDPLGFGFGDHRCVAETLAVAELTTVFAATRPEDRRAHREA
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgtctgtggaaccgcccagtttcccgttccaacgtgcctcggggatggacccccctgca
gagtacgctcgtcttcgagccacagaccctgtctcgagggtgaagttgttcgacggcagc
ttggcctggcttgtcaccaaatataaggatgtcacacaggtcgcaactgacgacaggcta
tccaaggtacgtgacaggcccggcttcccagagctgagcgccggagctgacctgttcgaa
aggagcatggtgagcaagtttttcaccgacgaacatgtgaaaaacctgcagccctttatt
cagaaaacagtcgacgaccttctggcctctatgaagacaaagggttgcgccgctggaccc
gtcgacttggttaaggaatttgcactgccagtcccttcatatattatttacactatcctc
ggcgtccctttcagcgacctggaatacctcacagaacaagttgccacccgatcaaatggc
agcggaacagccagggaggcctcaacagcgaaccaggaactgctgaattatatcggcaca
cttgtcgataagcgccttgccgagccgaagaatgatctcatcagtgaactggttgtcaac
caggtgagcaagggggttatagacaagtccgacgcagtccagattgcctttctcttgctc
gtcgccggcaacgcaacgctggtcaacatgatcaacctgcaccctgatcagttggatcag
ctcaagtcagacccgtcccgggcaggagcctttgtcaaggagctttgtcgctaccacacc
gcatcggcactggcaatgaagcgaacggcaaaggttgacgtcgagatcgggggacagctt
atcaaagctggcgagggcattattgcgtctaatcagtcggccaatcgggacgccgagatt
tttactgatcccgacaaattcgatatgaaccgcacatggcctgccgaggaccccctaggg
tttggttttggcgatcaccgatgcgttgcagagaccttggcggtggcagagctcaccact
gtatttgcagctaccagacctgaagatcgccgtgcccatagagaagcttga

DBGET integrated database retrieval system