KEGG   Methanosarcina barkeri Fusaro: Mbar_A3585
Entry
Mbar_A3585        CDS       T00271                                 
Name
(GenBank) methylthiol:coenzyme M methyltransferase
  KO
K16954  methylthiol:coenzyme M methyltransferase [EC:2.1.1.251]
Organism
mba  Methanosarcina barkeri Fusaro
Pathway
mba00920  Sulfur metabolism
mba01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mba00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Mbar_A3585
Enzymes [BR:mba01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.251  methylated-thiol---coenzyme M methyltransferase
     Mbar_A3585
SSDB
Motif
Pfam: URO-D
Other DBs
NCBI-ProteinID: AAZ72453
UniProt: Q465I9
LinkDB
Position
1:complement(4601232..4602335)
AA seq 367 aa
MVSEMTPTRRVMAAVLGGRVDYVPPANPLAQTTTELMQICNASWPKAHFDSKMMADLAAA
PYEVCGIEAARPQFDISLEAEVLGCKLDWDKPDRPPVIGPAYTDPSNVTWPDNLEEAGRI
PVVLGAIEELRTRYDGMLPVIPLLTSPFTIASHIAGVENMAKWTKTAPEKAHAFIEAATD
FVIAYGKLQTIYGAHIVFLADPSASGDLISAETYREFVLPAHKRIAKEISCPQILHICGD
TSKLLPYIKQSGIDCFSFDAVPVSYCRQVVGNEMSILGSLDVIDLMPNGTPEQVYNRTRE
CILQGADIVGTSCGLSFGTSLENLRAYVRACKETQIPKCDDVEDLIRQIGIGIGKNMREN
VLGGMKE
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggtaagtgaaatgactccaacccgaagagttatggcagcagtgcttggaggtagggtt
gattacgtacccccagcgaatcccctcgctcagactacaactgaactgatgcagatatgc
aatgcttcctggccaaaagcccactttgacagcaagatgatggcagaccttgcagccgct
ccctatgaagtttgtggtatagaggctgcacgtccccagtttgacatttctctcgaagcg
gaggttctggggtgtaaacttgactgggacaaaccggacagacctcccgtaataggtcct
gcttataccgatccctccaatgtaacctggcctgacaatctggaagaagccggaagaatt
ccggtagtgctcggagcgattgaggaactgaggacgcgctatgacggcatgcttcctgtt
atcccactacttacatctccttttacgatagcaagtcatatagcaggcgtcgaaaacatg
gcaaagtggacaaagaccgctccagaaaaagcacatgccttcattgaggcagcaacagat
ttcgtgatagcttacgggaagctgcagactatttatggagcacacatcgtcttcctcgcc
gacccttcggcttccggggacctgatttctgcggaaacgtacagagaattcgtacttcct
gcccacaaaagaatagcaaaggaaatcagctgtccccagatcttgcacatctgcggagat
acaagtaaacttctgccctacataaaacagagtggaattgactgcttctccttcgatgcc
gttccggtctcgtattgccgtcaggtagtgggcaatgaaatgtccatcctcggaagcctg
gatgttatagatcttatgccaaacggcacccccgaacaggtttataacagaacaagggaa
tgcatcctgcagggagctgatattgttgggacttcgtgtggactctcatttggaacctcc
ctcgaaaatctcagggcatatgtcagggcttgtaaagagacacaaatcccgaaatgtgat
gatgtggaagaccttatcaggcagattggaatcggtattggaaagaatatgagagaaaac
gtgttgggtgggatgaaggaatga

DBGET integrated database retrieval system