KEGG   Methanosarcina barkeri 227: MSBR2_0865
Entry
MSBR2_0865        CDS       T03914                                 
Name
(GenBank) Methylcobalamin:coenzyme M methyltransferase, methanol-specific
  KO
K16954  methylthiol:coenzyme M methyltransferase [EC:2.1.1.251]
Organism
mbar  Methanosarcina barkeri 227
Pathway
mbar00920  Sulfur metabolism
mbar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbar00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    MSBR2_0865
Enzymes [BR:mbar01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.251  methylated-thiol---coenzyme M methyltransferase
     MSBR2_0865
SSDB
Motif
Pfam: URO-D
Other DBs
NCBI-ProteinID: AKB57381
UniProt: A0A0E3LPZ5
LinkDB
Position
1107808..1108911
AA seq 367 aa
MVSEMTPTRRALAAVLGGRVDYVPPANPLAQTTTELMQICNASWPKAHFDSKMMADLAAA
PYEICGIEAARPQFDISLEAEVLGCKLDWNKPDRPPVTGPAYTDPADITWPDNLEEAGRI
PVVLGAIEELRKRYDGMLPVIPVLTSPFTVAGHIAGVENLVRWTKTDPEKAHAFIEAATD
FVIAYGKLQTAYGAHILFPADPSASGDLISGETYKEFVLPAHKRMAKEISCPLILHICGD
TSKLLPYIKQSGIDCFSFDAVPVWYCRQVMGNEMSILGSLDVIDLMPNGTPEQVYNRTRE
CILQGADIVGTACDVSFGTSLENLRAYVRACKETPIPKYDDVEDIIRQIGVGIGRNMKEN
VLGGMQK
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggtaagtgaaatgactccaacccgaagagctctggcagccgtgcttggaggcagggtt
gattacgtaccccccgctaatcccctcgctcagactacaacagaactgatgcagatatgc
aatgcttcctggccaaaagcccactttgacagcaagatgatggcagaccttgcagccgct
ccctatgaaatttgcggcatagaggctgcacgtccccagtttgatatttctcttgaagcg
gaggttttgggatgcaagcttgattggaacaaaccggaccgacctcccgtaacaggtcct
gcttataccgatcccgccgacataacctggcctgacaatctggaagaagccggaagaatc
ccggtagtgctcggagcaatcgaggaactgaggaagcggtacgatggtatgcttcctgtc
ataccagtcctgacatctccttttacagtagctggccacatagcaggggttgaaaacctg
gtaagatggacaaagaccgatcccgaaaaagcccatgcttttattgaggcagcaactgat
ttcgtgatagcttacggaaagttacagaccgcttacggggcacatatactttttccggca
gatccatcagcctcaggagacctgatttctggggaaacttacaaagaattcgtacttcct
gcccacaaaaggatggcaaaggaaatcagctgccctttgatcctgcacatctgcggagat
accagcaaacttctgccttacataaagcagagtggtatcgattgtttctcctttgatgcc
gtgccagtctggtactgccgtcaggtgatgggcaacgagatgtccattcttggaagcctg
gacgttatagaccttatgccaaacggcacccctgaacaggtatataatagaactcgagaa
tgcatcctgcagggagctgatattgttgggactgcatgcgacgtttcattcggtacttcc
cttgaaaacctcagggcctatgtcagggcctgcaaggagactccgattccaaaatatgat
gatgtggaagacatcatcaggcagatcggagtcggtattggaagaaacatgaaggaaaat
gtcctgggagggatgcagaaatga

DBGET integrated database retrieval system