KEGG   Drepanopeziza brunnea: MBM_04680
Entry
MBM_04680         CDS       T03105                                 
Name
(RefSeq) cytochrome P450 55A2
  KO
K15877  fungal nitric oxide reductase [EC:1.7.1.14]
Organism
mbe  Drepanopeziza brunnea
Pathway
mbe00910  Nitrogen metabolism
mbe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbe00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    MBM_04680
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mbe00199]
    MBM_04680
Enzymes [BR:mbe01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.14  nitric oxide reductase [NAD(P)+, nitrous oxide-forming]
     MBM_04680
Cytochrome P450 [BR:mbe00199]
 Cytochrome P450, fungi type
  CYP55 family
   MBM_04680
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 18760615
NCBI-ProteinID: XP_007292569
UniProt: K1X8T1
LinkDB
Position
Unknown
AA seq 409 aa
MSMSSATRTPPRFPFARPSGTEPALEYAQLRAKDPVSQVELFDGSIAWLVVKHKDICAVL
TDERLSKQRNRPGFPELSAGGKEAAKNKPTFVDMDPPQHMQQRSMVESVFTKQHIDSMRP
QIQKTVNSLLDKVIALGGAEPFDFVEKFALPVPSYTIYSILGVPLADLPKLTNFAAIRSN
GSGTATEASNANAALLSYMDGLVTTHLAEPQSDLISLLVAEQLLPGHLTQADVVQIAFLL
LIAGNATMVSMIALGVVTLLQHPAQLEELKRDPEKWAAPFVEELCRFHTASALATKRVAK
EDVVYGGKLIKAGEGIIAATQSGNRDEEVFGPTANEFDMKRVRGSEEALGYGWGAHRCVA
EWLARAELEIVFATLWQKLPNLKLAVAFAKVNYSPPKKDLGIGELPVVF
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgagcatgagctccgcaacgagaacaccccccagatttcccttcgctcgcccatctggg
acagagcctgctcttgagtatgcgcaactacgagccaaggatcctgtttcgcaagtggag
ctcttcgatgggagtattgcttggttggtagtcaagcacaaggacatctgtgctgtattg
actgatgagagactttcaaagcaaagaaaccgacctgggtttcccgagctttcagctgga
ggcaaagaagcggcgaagaacaagccaaccttcgttgacatggacccaccacaacacatg
cagcagaggagcatggtcgagtccgtcttcaccaagcagcatattgacagcatgcgtcca
cagatccagaagaccgtcaattctctcctcgacaaagtgattgcattgggcggcgccgag
cccttcgatttcgtggaaaagtttgcacttccagttccatcatacacgatctatagcatt
ctcggtgtccctctcgctgacctcccgaaactcacaaactttgcggcgatccgttccaat
ggctccgggaccgcgaccgaagcttcgaacgccaacgctgcgctcctatcctacatggat
ggcctggtaacaacccatctggccgagccacaatcagatttaatctctcttctggtggcc
gagcagcttcttcctggccacttgacgcaggcagacgtggtacaaattgcctttctgttg
ctcattgcgggaaatgctaccatggtctcgatgattgcccttggtgtggtcacgcttctc
caacatccggctcagctcgaggagttgaagcgggatccggagaagtgggccgcgccattc
gtggaggagttgtgtagattccatactgcttctgcgctggcgacgaaaagggtggcgaaa
gaggatgttgtgtatggtgggaagttgatcaaagccggagaaggcatcatcgcggcaaca
cagagtggtaaccgcgatgaggaggtgtttggaccgacggcgaatgagtttgacatgaag
cgtgtcaggggtagcgaggaagcattaggttacggatggggtgctcatcgatgtgtggcc
gaatggctggctagagcggaattggagatcgtttttgctacgctatggcagaagcttcca
aatctgaagctggcagttgcatttgcgaaggtgaactattcccctccgaagaaggatttg
ggtatcggagagctgccggttgtattttga

DBGET integrated database retrieval system