KEGG   Macrococcus bohemicus: HT586_04365
Entry
HT586_04365       CDS       T07164                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
mboe  Macrococcus bohemicus
Brite
KEGG Orthology (KO) [BR:mboe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mboe03000]
    HT586_04365
Transcription factors [BR:mboe03000]
 Prokaryotic type
  Other transcription factors
   Others
    HT586_04365
SSDB
Motif
Pfam: Bmp
Other DBs
NCBI-ProteinID: QRN49422
LinkDB
Position
831880..832887
AA seq 335 aa
MKKFLVFLVVLITVLGTIVYYKIPKYHEINSVGFIFPQSINDQTWGTEGYKAVLDIVQDY
DTNFYIQENIDDEEKTKLVLNEFLDRDVSIIYGQGSMYEKIFNEYAKKYPDVHFVFTNGK
SKHKNVSALNVEAYSMGFFAGYLASHESKTHKIGVIGAFDYQPEIKGFMDGAYNENKKTI
IQASFVKTWEYNNDVGVITKKMIENDVDVFYPAADGINSEVMGIVKDYDRKAIGYITDQS
YLGDFVLASTEQDISKLYQDIAREYSEGRLIGGTKYHGMKDNITSLHGYSPLVTSSTIEK
MDKLIEEYKKTGKLPNGKKAPENNVNVYLESDTEK
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgaaaaaatttcttgtttttcttgtagtgcttataacggtgcttggtacaatagtttat
tataaaataccaaaatatcatgaaataaatagtgttggttttattttcccgcaatcaatc
aatgatcagacttggggaacagaaggatataaggcagtattagacattgttcaggattat
gatacaaacttctatattcaggaaaatattgatgatgaagaaaaaactaaacttgtactg
aatgaatttcttgatagagatgtttctattatttatgggcaaggatctatgtatgagaaa
atttttaatgaatatgcaaaaaaatatcctgatgttcattttgtttttacaaatgggaaa
agtaaacataaaaatgtttctgcacttaatgtcgaagcatatagtatgggattttttgct
gggtacttagccagccatgaatcaaagactcataaaattggtgtaataggagcttttgat
tatcagcctgaaattaagggatttatggatggtgcatacaatgaaaataaaaagactatc
attcaggcttcttttgtaaagacgtgggagtataataatgatgttggtgtcattacaaag
aaaatgatagaaaatgatgtcgatgtattttatccggctgcagatggtattaatagtgaa
gttatggggattgttaaagattatgatcgtaaagcaatcggatatatcactgaccagagc
tatctaggtgactttgttctggcaagtactgagcaggatatttcgaagttgtatcaggat
attgcaagagaatactcggaaggtagactaataggtggaacaaaatatcatggcatgaaa
gataatattactagcctacatggttattcgccattggttacatcaagtacaattgaaaaa
atggataaactgattgaggaatataagaaaacaggtaaactaccaaacggtaaaaaagca
cctgaaaataacgtgaatgtatatctcgaaagtgatactgaaaaataa

DBGET integrated database retrieval system