KEGG   Macrococcus bohemicus: HT586_07200
Entry
HT586_07200       CDS       T07164                                 
Name
(GenBank) hypothetical protein
  KO
K21274  hexaprenyl-diphosphate synthase small subunit [EC:2.5.1.83]
Organism
mboe  Macrococcus bohemicus
Pathway
mboe00900  Terpenoid backbone biosynthesis
mboe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mboe00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HT586_07200
Enzymes [BR:mboe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.83  hexaprenyl diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     HT586_07200
SSDB
Motif
Pfam: HEPPP_synt_1 SBF2
Other DBs
NCBI-ProteinID: QRN49984
LinkDB
Position
complement(1399037..1399432)
AA seq 131 aa
MSFYERFLNDIDELKKRYPFFEMIPVNPEILTQTTMLDVDDQTKCAILAIDTSMRMQDLV
DDSNKDRYVLSTDLLSALFYRYLASPFQQYRYQILTDCVAKQNELKQQFSHSNDPALKEQ
IDNIFVMPFMA
NT seq 396 nt   +upstreamnt  +downstreamnt
atgagcttttatgaaagatttctaaatgatattgacgaattaaagaaacgatatcctttt
ttcgaaatgattccagttaatccggaaatattaacacagacgacaatgttagatgttgat
gatcagacgaaatgtgcaatacttgcgattgatacaagtatgcgtatgcaggatttggtg
gacgatagcaataaagatagatatgtgctgtcaactgatttattaagcgctttgttctat
cgttatctagcatctccttttcaacaatatcgttatcagatacttactgactgtgtcgca
aaacagaatgaacttaagcaacaattttctcattcaaatgatcctgcattgaaagaacaa
attgataatatttttgtaatgccttttatggcttaa

DBGET integrated database retrieval system