KEGG   Macrococcus brunensis: MGG13_06470
Entry
MGG13_06470       CDS       T08179                                 
Name
(GenBank) polyprenyl synthetase family protein
  KO
K21275  hexaprenyl-diphosphate synthase large subunit [EC:2.5.1.83]
Organism
mbru  Macrococcus brunensis
Pathway
mbru00900  Terpenoid backbone biosynthesis
mbru01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbru00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MGG13_06470
Enzymes [BR:mbru01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.83  hexaprenyl diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     MGG13_06470
SSDB
Motif
Pfam: polyprenyl_synt
Other DBs
NCBI-ProteinID: ULG73363
LinkDB
Position
complement(1247211..1248146)
AA seq 311 aa
MLKGQIKEVEAIINDIVSRDESRINAASAHILSSGGKRIRPYFVLLSGSFGQNRHVELIK
TASALEIVHMASLVHDDYIDNSSKRRGKDAIHEVWDGQTSVQTGHYLLASALQLISDIDN
PDFHQYFSDIILEVCYGEFDQLYDRYDSAVSLTEYLRRINRKTAVLIEASCKLGAMSTDT
DAQTVFHLAKFGHFMGMSYQIIDDILDYTSSEEVLGKPVGSDIRNGHVTLPLMFAAEDAA
VKKELNRLSADQTDEYFNQLIDYVKKKGIEPASTVSRKYAEKAKFHLLQLPESDDRQQME
ELLAKMTKRIF
NT seq 936 nt   +upstreamnt  +downstreamnt
atgttaaaggggcaaattaaagaggttgaagcgattattaatgacatcgtcagccgggat
gaatcgagaatcaatgcggcaagcgcgcatatcctgtcatcaggcggcaagagaatacgt
ccttattttgtcctgctgtcaggtagtttcggtcaaaatcgacatgttgaactgattaag
acagcttctgcacttgaaatcgtgcatatggcaagtcttgttcatgatgactatattgat
aatagctctaaaagacggggaaaagatgcgattcatgaagtgtgggatggccagacttct
gtccagacaggtcattacctgcttgcttctgcactgcagcttatctctgatatagacaac
cctgattttcatcagtacttctcagatatcatactcgaagtgtgttacggagagtttgat
cagttatatgaccgctatgattcagccgtcagtctgacagaatatttgagacggattaat
cgtaagacagctgttctgatagaggcaagctgtaaattaggtgcgatgagtacagacacc
gatgcacagaccgtcttccatctagctaaatttggtcactttatgggcatgagctatcag
attattgatgacatacttgattacaccagctctgaagaggtgctcggtaaacctgtgggc
agcgacatcaggaatggtcatgtgacattgccgttgatgttcgcagctgaagacgctgca
gtcaaaaaagaactgaaccgtttgtcagcagatcagactgatgaatatttcaatcagctg
attgactatgttaagaagaagggaatagagcctgcttctactgtcagtagaaaatatgct
gaaaaagcaaagtttcatttacttcagttacctgagagtgatgaccgtcagcagatggaa
gaactgctcgctaaaatgacaaaaagaatattttga

DBGET integrated database retrieval system