KEGG Orthology (KO) [BR:mcc00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
100423709 (POLR3K)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:mcc03021]
100423709 (POLR3K)
Transcription machinery [BR:mcc03021]
Eukaryotic type
RNA polymerase III system
RNA polymerase III
Pol III specific subunits
100423709 (POLR3K)
KEGG Orthology (KO) [BR:mcc00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
100426798
09124 Replication and repair
03420 Nucleotide excision repair
100426798
09160 Human Diseases
09164 Neurodegenerative disease
05016 Huntington disease
100426798
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:mcc03021]
100426798
03400 DNA repair and recombination proteins [BR:mcc03400]
100426798
Transcription machinery [BR:mcc03021]
Eukaryotic type
RNA polymerase II system
RNA polymerase II
Pol I, II, III common subunits
100426798
RNA polymerase III system
RNA polymerase III
100426798
RNA polymerase I system
RNA polymerase I
100426798
DNA repair and recombination proteins [BR:mcc03400]
Eukaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
TCR (transcription coupled repair) factors
DNA-directed RNA polymerase II complex
100426798
KEGG Orthology (KO) [BR:mcc00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
100429040 (POLR2H)
09124 Replication and repair
03420 Nucleotide excision repair
100429040 (POLR2H)
09160 Human Diseases
09164 Neurodegenerative disease
05016 Huntington disease
100429040 (POLR2H)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:mcc03021]
100429040 (POLR2H)
03400 DNA repair and recombination proteins [BR:mcc03400]
100429040 (POLR2H)
Transcription machinery [BR:mcc03021]
Eukaryotic type
RNA polymerase II system
RNA polymerase II
Pol I, II, III common subunits
100429040 (POLR2H)
RNA polymerase III system
RNA polymerase III
100429040 (POLR2H)
RNA polymerase I system
RNA polymerase I
100429040 (POLR2H)
DNA repair and recombination proteins [BR:mcc03400]
Eukaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
TCR (transcription coupled repair) factors
DNA-directed RNA polymerase II complex
100429040 (POLR2H)
150 aa
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVI
ASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGG
LLMRLQGDANNLHGFEVDSRVYLLMKKLAF
KEGG Orthology (KO) [BR:mcc00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
114671810
09124 Replication and repair
03420 Nucleotide excision repair
114671810
09160 Human Diseases
09164 Neurodegenerative disease
05016 Huntington disease
114671810
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:mcc03021]
114671810
03400 DNA repair and recombination proteins [BR:mcc03400]
114671810
Transcription machinery [BR:mcc03021]
Eukaryotic type
RNA polymerase II system
RNA polymerase II
Pol I, II, III common subunits
114671810
RNA polymerase III system
RNA polymerase III
114671810
RNA polymerase I system
RNA polymerase I
114671810
DNA repair and recombination proteins [BR:mcc03400]
Eukaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
TCR (transcription coupled repair) factors
DNA-directed RNA polymerase II complex
114671810
KEGG Orthology (KO) [BR:mcc00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
114677647
09124 Replication and repair
03420 Nucleotide excision repair
114677647
09160 Human Diseases
09164 Neurodegenerative disease
05016 Huntington disease
114677647
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:mcc03021]
114677647
03400 DNA repair and recombination proteins [BR:mcc03400]
114677647
Transcription machinery [BR:mcc03021]
Eukaryotic type
RNA polymerase II system
RNA polymerase II
Pol I, II, III common subunits
114677647
RNA polymerase III system
RNA polymerase III
114677647
RNA polymerase I system
RNA polymerase I
114677647
DNA repair and recombination proteins [BR:mcc03400]
Eukaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
TCR (transcription coupled repair) factors
DNA-directed RNA polymerase II complex
114677647
KEGG Orthology (KO) [BR:mcc00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
695330 (POLR3G)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:mcc03021]
695330 (POLR3G)
Transcription machinery [BR:mcc03021]
Eukaryotic type
RNA polymerase III system
RNA polymerase III
Pol III specific subunits
695330 (POLR3G)
KEGG Orthology (KO) [BR:mcc00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
696943 (POLR3C)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:mcc03021]
696943 (POLR3C)
Transcription machinery [BR:mcc03021]
Eukaryotic type
RNA polymerase III system
RNA polymerase III
Pol III specific subunits
696943 (POLR3C)
KEGG Orthology (KO) [BR:mcc00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
697901 (POLR3E)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:mcc03021]
697901 (POLR3E)
Transcription machinery [BR:mcc03021]
Eukaryotic type
RNA polymerase III system
RNA polymerase III
Pol III specific subunits
697901 (POLR3E)
KEGG Orthology (KO) [BR:mcc00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
697927 (POLR3F)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:mcc03021]
697927 (POLR3F)
Transcription machinery [BR:mcc03021]
Eukaryotic type
RNA polymerase III system
RNA polymerase III
Pol III specific subunits
697927 (POLR3F)