Macaca mulatta (rhesus monkey): 100424064 Help Entry 100424064         CDS       T01028                                  Name (RefSeq) growth-regulated alpha protein-like   KO K05505   C-X-C motif chemokine 1/2/3 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04060   Cytokine-cytokine receptor interaction mcc04061   Viral protein interaction with cytokine and cytokine receptor mcc04062   Chemokine signaling pathway mcc04064   NF-kappa B signaling pathway mcc04621   NOD-like receptor signaling pathway mcc04657   IL-17 signaling pathway mcc04668   TNF signaling pathway mcc04936   Alcoholic liver disease mcc05134   Legionellosis mcc05146   Amoebiasis mcc05167   Kaposi sarcoma-associated herpesvirus infection mcc05323   Rheumatoid arthritis mcc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     100424064    04668 TNF signaling pathway     100424064   09133 Signaling molecules and interaction    04061 Viral protein interaction with cytokine and cytokine receptor     100424064  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     100424064    04062 Chemokine signaling pathway     100424064  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     100424064   09171 Infectious disease: bacterial    05134 Legionellosis     100424064   09174 Infectious disease: parasitic    05146 Amoebiasis     100424064   09163 Immune disease    05323 Rheumatoid arthritis     100424064   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100424064   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100424064  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mcc04052]     100424064 Cytokines and neuropeptides [BR:mcc04052]  Cytokines   Chemokines    100424064 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  100424064 NCBI-ProteinID:  XP_002804334 LinkDB All DBs Position 5:59676631..59678953 Genome browser AA seq 107 aa AA seqDB search MARAALSAAPSNPRLLRVALLLLLLVASGQRAAGAPVATELRCQCLQTLQGIHPKNIQSV IVKAPGPHCAETEVIATLKNGQKACLNPASPMVQKIIEKILNKGSTD NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggcacgcgccgcgctctccgcagcccccagcaatcctcggctcctgcgggtggctctg ctgctcctgctcctagtggcctctggacagcgcgcagcaggagcacccgtggccactgaa ctgcgctgccagtgcttgcagaccctgcagggaattcaccccaagaacatccaaagtgtg attgtgaaggccccaggaccccactgcgcggaaaccgaagtcatagccacactcaagaat gggcagaaagcttgtctcaaccccgcatcccccatggttcagaaaatcatcgaaaagata ctgaacaaggggagcaccgactga

Macaca mulatta (rhesus monkey): 574222 Help Entry 574222            CDS       T01028                                  Symbol CXCL1 Name (RefSeq) growth-regulated alpha protein precursor   KO K05505   C-X-C motif chemokine 1/2/3 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04060   Cytokine-cytokine receptor interaction mcc04061   Viral protein interaction with cytokine and cytokine receptor mcc04062   Chemokine signaling pathway mcc04064   NF-kappa B signaling pathway mcc04621   NOD-like receptor signaling pathway mcc04657   IL-17 signaling pathway mcc04668   TNF signaling pathway mcc04936   Alcoholic liver disease mcc05134   Legionellosis mcc05146   Amoebiasis mcc05167   Kaposi sarcoma-associated herpesvirus infection mcc05323   Rheumatoid arthritis mcc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     574222 (CXCL1)    04668 TNF signaling pathway     574222 (CXCL1)   09133 Signaling molecules and interaction    04061 Viral protein interaction with cytokine and cytokine receptor     574222 (CXCL1)  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     574222 (CXCL1)    04062 Chemokine signaling pathway     574222 (CXCL1)  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     574222 (CXCL1)   09171 Infectious disease: bacterial    05134 Legionellosis     574222 (CXCL1)   09174 Infectious disease: parasitic    05146 Amoebiasis     574222 (CXCL1)   09163 Immune disease    05323 Rheumatoid arthritis     574222 (CXCL1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     574222 (CXCL1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     574222 (CXCL1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mcc04052]     574222 (CXCL1) Cytokines and neuropeptides [BR:mcc04052]  Cytokines   Chemokines    574222 (CXCL1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  574222 NCBI-ProteinID:  NP_001028050 Ensembl:  ENSMMUG00000042117 UniProt:  Q8HXZ4 LinkDB All DBs Position 5:complement(59939742..59940808) Genome browser AA seq 107 aa AA seqDB search MARAALSAAPSNPRFLQVALLLLLLVATGRRAAGASVVTELRCQCLQTLQGIHPKNIQSV NVKAPGPHCAETEVIATLKNGQKACLNPASPMVQKIIKKMLNCDKSN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggcccgcgccgcgctctccgcagcccctagcaatccccggttcctgcaggtggcgctg ctgctcctgctcctggtggccaccggccggcgcgcagcaggagcgtccgtggtcactgaa ttgcgctgccagtgcttgcagaccctgcagggaattcaccccaagaatatccaaagtgtg aacgtgaaggccccaggaccccactgcgccgaaaccgaagtcatagccacactcaagaat gggcagaaagcttgtctcaaccccgcatcccccatggttcagaaaatcatcaaaaagatg ctgaactgtgacaaatccaactga

Macaca mulatta (rhesus monkey): 574223 Help Entry 574223            CDS       T01028                                  Symbol CXCL3 Name (RefSeq) C-X-C motif chemokine 3 precursor   KO K05505   C-X-C motif chemokine 1/2/3 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04060   Cytokine-cytokine receptor interaction mcc04061   Viral protein interaction with cytokine and cytokine receptor mcc04062   Chemokine signaling pathway mcc04064   NF-kappa B signaling pathway mcc04621   NOD-like receptor signaling pathway mcc04657   IL-17 signaling pathway mcc04668   TNF signaling pathway mcc04936   Alcoholic liver disease mcc05134   Legionellosis mcc05146   Amoebiasis mcc05167   Kaposi sarcoma-associated herpesvirus infection mcc05323   Rheumatoid arthritis mcc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     574223 (CXCL3)    04668 TNF signaling pathway     574223 (CXCL3)   09133 Signaling molecules and interaction    04061 Viral protein interaction with cytokine and cytokine receptor     574223 (CXCL3)  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     574223 (CXCL3)    04062 Chemokine signaling pathway     574223 (CXCL3)  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     574223 (CXCL3)   09171 Infectious disease: bacterial    05134 Legionellosis     574223 (CXCL3)   09174 Infectious disease: parasitic    05146 Amoebiasis     574223 (CXCL3)   09163 Immune disease    05323 Rheumatoid arthritis     574223 (CXCL3)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     574223 (CXCL3)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     574223 (CXCL3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mcc04052]     574223 (CXCL3) Cytokines and neuropeptides [BR:mcc04052]  Cytokines   Chemokines    574223 (CXCL3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  574223 NCBI-ProteinID:  NP_001028051 Ensembl:  ENSMMUG00000008367 UniProt:  Q8HXZ3 LinkDB All DBs Position 5:59748163..59748683 Genome browser AA seq 107 aa AA seqDB search MAHATLSAAPSNPRLLRVALLLLLLVATGRRATGAPVATELRCQCLQTLQGIHPKNIQSV IVKAPGPHCAETEVIATLKNGQKACLNPASPMVQKIIEKILNKGSTN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggcccacgccacgctctccgcagcccccagcaatcctcggctcctgcgggtggcgctg ctgctcctgctcctggtggccaccggaaggcgggcaacaggagcacccgtggccactgaa ctgcgctgccagtgcttgcagaccctgcagggaattcaccccaagaacatccaaagtgtg attgtgaaggccccaggaccccactgcgccgaaaccgaagtcatagccacactcaagaat gggcagaaagcttgtctcaaccccgcatcccccatggttcagaaaatcatcgaaaagata ctgaacaaggggagcaccaactga

Macaca mulatta (rhesus monkey): 702067 Help Entry 702067            CDS       T01028                                  Name (RefSeq) uncharacterized protein LOC702067   KO K05505   C-X-C motif chemokine 1/2/3 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04060   Cytokine-cytokine receptor interaction mcc04061   Viral protein interaction with cytokine and cytokine receptor mcc04062   Chemokine signaling pathway mcc04064   NF-kappa B signaling pathway mcc04621   NOD-like receptor signaling pathway mcc04657   IL-17 signaling pathway mcc04668   TNF signaling pathway mcc04936   Alcoholic liver disease mcc05134   Legionellosis mcc05146   Amoebiasis mcc05167   Kaposi sarcoma-associated herpesvirus infection mcc05323   Rheumatoid arthritis mcc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     702067    04668 TNF signaling pathway     702067   09133 Signaling molecules and interaction    04061 Viral protein interaction with cytokine and cytokine receptor     702067  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     702067    04062 Chemokine signaling pathway     702067  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     702067   09171 Infectious disease: bacterial    05134 Legionellosis     702067   09174 Infectious disease: parasitic    05146 Amoebiasis     702067   09163 Immune disease    05323 Rheumatoid arthritis     702067   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     702067   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     702067  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mcc04052]     702067 Cytokines and neuropeptides [BR:mcc04052]  Cytokines   Chemokines    702067 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  702067 NCBI-ProteinID:  XP_001092240 LinkDB All DBs Position 5:59613745..59616338 Genome browser AA seq 263 aa AA seqDB search MSSREVTPPGKDVARSLRGSKGSDPRSTVLGSPSAPRRRNLGISESGGLSLPLQGFGAES EHSTVGGSYARQPDLAFSRECPHPSPPQRRGCAFLPDSGSIWISGNFPGPGLRAFQPQPC IKGVHHAQRATEPRPQAAPCQLSLSSHSRPKRLLSPMASPALSTAPSNLRLLRVALLLLL LVAASRRAAGAPLVTELRCQCLQTLHGIHPKNIQSVNVKAPGPHCAQTEVIATLKNGQKA CLNPASPMVKKIIGKMLNNGKSN NT seq 792 nt NT seq  +upstreamnt  +downstreamnt atgtcttccagagaagtaactccccccggtaaggatgtagcgcggtccctacgtggttct aagggatcagacccgcgaagcactgtactgggttcaccaagcgcccctcgcaggcgcaat ctcggtatctcggagagcggtgggctctcgctccccctccagggatttggagcagaaagc gaacattccacagttggcgggagttacgcaagacagccagacttggccttcagtcgtgag tgcccccaccccagtccaccccaaaggcggggctgcgccttccttccggactcgggatcg atctggatctccgggaatttccctggcccggggctccgggctttccagccccagccatgc ataaaaggagttcaccatgctcagagagccacagaacccaggccacaagcagctccctgc caactctccctctcctcgcacagccgcccgaaacgcctgctgagccccatggcctccccg gctctctccaccgcccctagcaatctccggctcctgcgggtggcgctgctgcttctgctc ctggtggccgccagccggcgcgcagcaggagcgcccctggtcactgaactgcgctgccag tgcttgcagaccctgcacggaattcaccccaagaacatccaaagtgtgaatgtgaaggcc ccaggaccccactgcgcccaaaccgaagtcatagccacactcaagaatgggcagaaagct tgtctcaatcccgcatcccccatggttaagaaaatcatcggaaagatgctgaacaatggc aaatccaactga

Macaca mulatta (rhesus monkey): 703390 Help Entry 703390            CDS       T01028                                  Name (RefSeq) growth-regulated alpha protein-like   KO K05505   C-X-C motif chemokine 1/2/3 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04060   Cytokine-cytokine receptor interaction mcc04061   Viral protein interaction with cytokine and cytokine receptor mcc04062   Chemokine signaling pathway mcc04064   NF-kappa B signaling pathway mcc04621   NOD-like receptor signaling pathway mcc04657   IL-17 signaling pathway mcc04668   TNF signaling pathway mcc04936   Alcoholic liver disease mcc05134   Legionellosis mcc05146   Amoebiasis mcc05167   Kaposi sarcoma-associated herpesvirus infection mcc05323   Rheumatoid arthritis mcc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     703390    04668 TNF signaling pathway     703390   09133 Signaling molecules and interaction    04061 Viral protein interaction with cytokine and cytokine receptor     703390  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     703390    04062 Chemokine signaling pathway     703390  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     703390   09171 Infectious disease: bacterial    05134 Legionellosis     703390   09174 Infectious disease: parasitic    05146 Amoebiasis     703390   09163 Immune disease    05323 Rheumatoid arthritis     703390   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     703390   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     703390  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mcc04052]     703390 Cytokines and neuropeptides [BR:mcc04052]  Cytokines   Chemokines    703390 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Lenti_VIF_2 Motif Other DBs NCBI-GeneID:  703390 NCBI-ProteinID:  XP_001091688 LinkDB All DBs Position 5:59839567..59842925 Genome browser AA seq 198 aa AA seqDB search MTSQPQPCIKTVHRSRAATEPGLQAPSCQFPCSSHRRPTSVLSLMACAAPHAVPGPPRLL RVALLLLVLLVATCRRAAGAPVVTELRCQCLQTLQGIHPKNIRSVNVKFPGPHCAQTEVI AALKNGQKVCLNSTAPMVQKIIQKMLNSGNANGPREKEKAYPLQFLKESILRGIKVKEEK QLAPRHTWTVFNVFNCFL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgacttctcagccccaaccatgcattaaaacggttcaccgatctcgcgcagccacagag cctgggctgcaggcaccttcctgtcagttcccctgctcctcgcaccgccgcccgaccagc gttctgagcctgatggcctgcgccgcaccccacgctgtccccggccctccccggctcctg cgggtggcgctgctgctgctcgtgctcctggtggccacctgccggcgcgcggcaggagca cccgtggtcactgaactgcgctgccagtgcttgcagaccctgcagggaattcaccccaag aacatccgaagtgtgaacgtgaagttccctggaccccactgcgcccaaaccgaagtcata gctgcactcaagaatgggcagaaagtgtgtctcaactccacagcacccatggttcagaaa atcatccaaaagatgctgaacagtggcaacgctaacggacctagagagaaggagaaagca tatccgctacaattcctaaaggagtctattcttagaggaatcaaagtgaaagaagaaaaa caattagctcctcggcacacttggactgtgtttaatgtgtttaactgcttcttatga

DBGET integrated database retrieval system