Macaca mulatta (rhesus monkey): 718948 Help Entry 718948            CDS       T01028                                  Symbol BAX Name (RefSeq) apoptosis regulator BAX   KO K02159   apoptosis regulator BAX Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc01521   EGFR tyrosine kinase inhibitor resistance mcc01522   Endocrine resistance mcc01524   Platinum drug resistance mcc04071   Sphingolipid signaling pathway mcc04115   p53 signaling pathway mcc04141   Protein processing in endoplasmic reticulum mcc04210   Apoptosis mcc04211   Longevity regulating pathway mcc04215   Apoptosis - multiple species mcc04217   Necroptosis mcc04722   Neurotrophin signaling pathway mcc04932   Non-alcoholic fatty liver disease mcc04933   AGE-RAGE signaling pathway in diabetic complications mcc05012   Parkinson disease mcc05014   Amyotrophic lateral sclerosis mcc05016   Huntington disease mcc05020   Prion disease mcc05022   Pathways of neurodegeneration - multiple diseases mcc05132   Salmonella infection mcc05152   Tuberculosis mcc05160   Hepatitis C mcc05161   Hepatitis B mcc05162   Measles mcc05163   Human cytomegalovirus infection mcc05164   Influenza A mcc05165   Human papillomavirus infection mcc05166   Human T-cell leukemia virus 1 infection mcc05167   Kaposi sarcoma-associated herpesvirus infection mcc05168   Herpes simplex virus 1 infection mcc05169   Epstein-Barr virus infection mcc05170   Human immunodeficiency virus 1 infection mcc05200   Pathways in cancer mcc05202   Transcriptional misregulation in cancer mcc05203   Viral carcinogenesis mcc05210   Colorectal cancer mcc05212   Pancreatic cancer mcc05213   Endometrial cancer mcc05214   Glioma mcc05216   Thyroid cancer mcc05217   Basal cell carcinoma mcc05218   Melanoma mcc05220   Chronic myeloid leukemia mcc05222   Small cell lung cancer mcc05223   Non-small cell lung cancer mcc05224   Breast cancer mcc05225   Hepatocellular carcinoma mcc05226   Gastric cancer mcc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mcc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     718948 (BAX)  09130 Environmental Information Processing   09132 Signal transduction    04071 Sphingolipid signaling pathway     718948 (BAX)  09140 Cellular Processes   09143 Cell growth and death    04215 Apoptosis - multiple species     718948 (BAX)  09150 Organismal Systems   09156 Nervous system    04722 Neurotrophin signaling pathway     718948 (BAX)   09149 Aging    04211 Longevity regulating pathway     718948 (BAX)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     718948 (BAX)    05202 Transcriptional misregulation in cancer     718948 (BAX)    05203 Viral carcinogenesis     718948 (BAX)   09162 Cancer: specific types    05210 Colorectal cancer     718948 (BAX)    05212 Pancreatic cancer     718948 (BAX)    05225 Hepatocellular carcinoma     718948 (BAX)    05226 Gastric cancer     718948 (BAX)    05214 Glioma     718948 (BAX)    05216 Thyroid cancer     718948 (BAX)    05220 Chronic myeloid leukemia     718948 (BAX)    05217 Basal cell carcinoma     718948 (BAX)    05218 Melanoma     718948 (BAX)    05213 Endometrial cancer     718948 (BAX)    05224 Breast cancer     718948 (BAX)    05222 Small cell lung cancer     718948 (BAX)    05223 Non-small cell lung cancer     718948 (BAX)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     718948 (BAX)    05170 Human immunodeficiency virus 1 infection     718948 (BAX)    05161 Hepatitis B     718948 (BAX)    05160 Hepatitis C     718948 (BAX)    05164 Influenza A     718948 (BAX)    05162 Measles     718948 (BAX)    05163 Human cytomegalovirus infection     718948 (BAX)    05167 Kaposi sarcoma-associated herpesvirus infection     718948 (BAX)    05169 Epstein-Barr virus infection     718948 (BAX)    05165 Human papillomavirus infection     718948 (BAX)   09171 Infectious disease: bacterial    05152 Tuberculosis     718948 (BAX)   09164 Neurodegenerative disease    05012 Parkinson disease     718948 (BAX)    05014 Amyotrophic lateral sclerosis     718948 (BAX)    05016 Huntington disease     718948 (BAX)    05020 Prion disease     718948 (BAX)    05022 Pathways of neurodegeneration - multiple diseases     718948 (BAX)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     718948 (BAX)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     718948 (BAX)    04933 AGE-RAGE signaling pathway in diabetic complications     718948 (BAX)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     718948 (BAX)    01524 Platinum drug resistance     718948 (BAX)    01522 Endocrine resistance     718948 (BAX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:mcc03029]     718948 (BAX)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mcc02000]     718948 (BAX) Mitochondrial biogenesis [BR:mcc03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Fission and Fusion factors     718948 (BAX) Transporters [BR:mcc02000]  Other transporters   Pores ion channels [TC:1]    718948 (BAX) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 TetR_C_30 Motif Other DBs NCBI-GeneID:  718948 NCBI-ProteinID:  NP_001247945 Ensembl:  ENSMMUG00000003907 UniProt:  F6ZV78 LinkDB All DBs Position 19:48936161..48944138 Genome browser AA seq 192 aa AA seqDB search MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELALDPVPQDASTKRLS ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTILVAGV LTASLTIWKKMG NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atggacgggtccggggagcagcccagaggcggggggcccaccagctctgagcagatcatg aagacaggggcccttttgcttcagggtttcatccaggatcgagcagggcgaatggggggg gagacacccgagctggccctggacccggtgcctcaggatgcgtccaccaagaggctgagc gagtgtctcaagcgcatcggggacgaactggacagtaacatggagctgcagaggatgatt gccgccgtggacacagactccccccgagaggtctttttccgagtggcagctgacatgttt tctgacggcaacttcaactggggccgtgttgtcgcccttttctactttgccagcaaactg gtgctcaaggccctgtgtaccaaggtgcccgaactgatcagaaccatcatgggctggacg ctggacttcctccgggagcggctgttgggctggatccaagaccagggtggttgggacggc ctcctctcctactttgggacgcccacgtggcagaccgtgaccatcttggtggctggagta ctcaccgcctccctcaccatctggaagaagatgggctga

DBGET integrated database retrieval system