KEGG   Macaca mulatta (rhesus monkey): 722773
Entry
722773            CDS       T01028                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8 isoform X2
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    722773 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    722773 (TNFRSF8)
   04090 CD molecules [BR:mcc04090]
    722773 (TNFRSF8)
Cytokine receptors [BR:mcc04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   722773 (TNFRSF8)
CD molecules [BR:mcc04090]
 Proteins
  722773 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 722773
NCBI-ProteinID: XP_014968795
Ensembl: ENSMMUG00000008340
LinkDB
Position
1:complement(212307567..212383899)
AA seq 546 aa
MGLFPTQQCPQRPADCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKMPCAWNSSRVCECQ
PGMFCAVSVVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEP
SSGTIPQAKPTPVSPATSNASTMPLRGGTRLAQEAASKLTRAPGSPSSVGRPSSDPGLSP
TQPCPQGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRICECRPGMIC
ATSATNSCARCVPYPICAAETGTKPQDMAEKDTTFEAPPVGTQPDCSPTPENGEAPASTS
PTLSSLVDSQASKTLPIPTSAPIALSSTGKPVLDAGPVLFWVILVLAVVVGSSTFLLCHR
RACRKRIRQKLHLCYPVQTSRPKLELVDSRPRRSSTQFESGTFVTKPSAEELGLMSLPPK
ETCRNVGAACPESLPLWDASPAGGPSSPRDLPEPRVSTEHTNNRIEKIYIMKADTVIVGT
VKAELPEGQGLAGPAEPELEEELEADHAPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLP
TAASGK
NT seq 1641 nt   +upstreamnt  +downstreamnt
atggggctgttcccgacacagcagtgcccacagaggcctgctgactgcaggaagcagtgt
gaacctgactactacctggatgaggccggccgctgtacggcctgcgtgagttgttctcga
gacgacctcgtggagaagatgccgtgtgcgtggaactcctcccgtgtctgcgaatgtcag
cctggcatgttctgtgccgtgtctgtcgtcaactcctgtgcccgctgcttcttccattct
gtctgcccagcagggatgattgtcaagttcccaggcacggcgcagaagaacacggtctgt
gaaccagcttccccaggcgtcagccctgcctgtgccagcccggagaactgcaaggaaccc
tccagtggcaccatcccccaggccaagcccaccccggtgtccccagcaacctccaatgcc
agcaccatgcctctaagagggggcacccgcctcgcccaggaagctgcttctaaactgaca
agggctcccggctctccctcctccgtgggaaggcctagttcggatccaggtctgtcccca
acgcagccgtgcccacaggggtctggcgactgcaggaagcagtgtgagcctgactactac
ctggacgaggctggccgctgcacggcctgcgtgagctgttctcgagacgacctcgtggag
aagacgccgtgtgcatggaactcctcccgcatctgcgaatgtcgacctggcatgatctgt
gccacatcagccaccaactcctgtgcccgctgtgtcccctacccaatctgtgcagcagag
acaggcaccaagccccaggatatggctgagaaggacaccacctttgaggcgccacccgtg
gggacccagcctgactgcagccccaccccagagaatggcgaggcgcctgccagtaccagc
cccactctgagctccctggtggactcccaggccagtaagacgctgcccatcccaaccagc
gctcccatcgctctctcctccacggggaagcccgttctggatgcagggccagtgctcttc
tgggtgatcctggtgctggctgtggtggtcggctccagcaccttcctcctgtgccaccgg
agggcctgcaggaagcgaattcgccagaagctccacctgtgctacccggtccagacctcc
cggcccaagctagagcttgtggattccagacccaggaggagctcaacgcagttcgagagt
ggtacgtttgtgacaaaacccagtgcggaagagctggggttaatgagcctgccaccgaag
gagacctgccgcaacgtgggggcagcctgcccggagagcctgccgctgtgggatgccagc
ccggccgggggcccctcgtcccccagggaccttcctgagccccgggtgtccacggagcac
accaataacaggattgagaaaatctacatcatgaaggccgacactgtgatcgtgggaact
gtgaaggctgagctgccagagggccagggcctggcggggccggcagagcccgagttggag
gaggagctggaggcggaccatgccccccactaccccgagcaggagacagaaccgcctctg
ggcagctgcagtgatgtcatgctgtccgtggaagaggaagggaaagaagaccccttgccc
acagctgcctctggaaagtga

DBGET integrated database retrieval system