KEGG   Macaca fascicularis (crab-eating macaque): 102147272
Entry
102147272         CDS       T02918                                 
Symbol
ITGAX
Name
(RefSeq) integrin alpha-X isoform X1
  KO
K06462  integrin alpha X
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04610  Complement and coagulation cascades
mcf04810  Regulation of actin cytoskeleton
mcf05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102147272 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    102147272 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102147272 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mcf04515]
    102147272 (ITGAX)
   04090 CD molecules [BR:mcf04090]
    102147272 (ITGAX)
Cell adhesion molecules [BR:mcf04515]
 Integrins
  Integrin alpha subunits
   102147272 (ITGAX)
CD molecules [BR:mcf04090]
 Proteins
  102147272 (ITGAX)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 Integrin_alpha VWA_CoxE FG-GAP_2
Other DBs
NCBI-GeneID: 102147272
NCBI-ProteinID: XP_015298151
Ensembl: ENSMFAG00000032646
LinkDB
Position
20:28768297..28798184
AA seq 1154 aa
MTRTRAALLLFTALATSLGFNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQERTAA
NQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLAATTSPPQLLACGPTVHHGCGRNM
YLTGLCFLLAPTQLTRRLPASGQECPRQELDIVFLIDGSGSISSGNFAMMMNFVRAVINQ
FQRPSTQFSLMQFSSKFDIHFTFEEFRRTSNPLDLLASVHQLTGFTHTATAIQKVVRELF
QASHGARGDATKILIVITDGRKEGDSLDYKDVIPMADAAGITRYAIGVGSAFQNRNSWKE
LNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVF
TPDGPILGAVGSFTWSGGAFLYPPNMNPTFINMSQENVDMRDSYLGYSTELALWKGVQNL
VLGAPRYQHTGKAAIFTQVSGQWRLKAEVTGTQIGSYFGASLCSVDVDGDGSTDLILIGA
PHYYEQTRGGQVSVCPLPRGWRRWWCDAVLHGEQGHPWGRFGAALTVLGDVNGDKLTDVV
IGAPGEEENQGAVYLFHGALGLSIGPSHSQRIAGSQLSPRLQYFGQALSGGQDLTQDGLV
DLAVGARGQALLLRTRPVLWVQVSIQFKPAEIPRSAFECREQMVSDQILGQSSICLYIDK
RSKNLLGSHDLQSSLTVDLALDPGRLSPRATFQETKNRSLSRVQVLGLETYCETFTLLLP
TCVEDSVTPITLRLNFTLVGEPLPAFRNLRPMLAADAQRYFMASLPFEKNCGADHICQDD
LGISFSFPGLKTLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRHVAEGQKQGQ
LRSLRLTCDSAPVGSQGTWTTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANV
SSENNTPRTNKTTFQLALPLKYAVYTVASSHEQSTKYLNFSDSEEKENHVAVHRYQVNNL
GQRDLPVSINFWVPVELNQEAVWMEVEVSHPQNPSLRCSSEKIASPASDFLAHIQKNPVL
DCSIAGCLRFRCDIPSFSVQEELHFTLKGNLSFGWVRQTSQKKVSVVSVAEITFDTSVYS
QLPGQEAFMRAQTTTVLEKYEVHNPTPLIVGSSIGGLLLLALITAALYKVGFFKRQYKQM
MEEANGQIAPENGT
NT seq 3465 nt   +upstreamnt  +downstreamnt
atgaccaggaccagggcagcgctcctcctgttcacagccttagcaacttctctgggtttc
aacttggacacagaggagctgacagccttccgtgtggacagcgctgggtttggagacagc
gtggtccagtatgccaactcctgggtggtggttggagccccgcaagagagaacagctgcc
aaccaaacgggcggcctctaccagtgcggctacagcaccggtgcctgtgagcccattggc
ctgcaggtccccccggaggccgtgaacatgtccctgggcctgtccctggcggctaccacc
agccccccccagctgctggcctgcggccccaccgtgcaccacgggtgtgggaggaacatg
tacctgaccggactctgcttcctcctggcccccacccagctcacccggaggctcccggcg
tccgggcaggagtgcccaagacaggagctggacattgtgttcctgattgatggctcgggc
agcatctcctctggcaactttgccatgatgatgaacttcgtgagagctgtgataaaccag
ttccagagacccagcacccagttttccctgatgcagttctccagtaaatttgacatacac
ttcactttcgaggaattcaggcgcacctcaaaccccctcgacctgttggcttctgttcac
cagctgacagggttcacacacacggccactgccatccaaaaagtcgtgcgcgaattgttc
caggcctcacatggggcccgtggggatgccaccaaaattctcattgtcatcactgatggg
aggaaagaaggcgacagcctggattataaggatgtcatccccatggctgatgcagcaggc
atcacccgctatgcaattggggttggatcagcttttcaaaacagaaactcttggaaagaa
ttaaatgacattgcatcgaagccctcccaggaacacatatttaaagtggaggactttgat
gctctgaaagatattcaaaaccagctgaaggagaagatctttgccattgaaggtacggag
accacaagcagcagctccttcgaattggagatggcgcaggagggcttcagtgctgtgttc
acgcctgatggccccattctgggggctgtggggagcttcacctggtctggaggtgccttc
ctgtaccccccaaatatgaaccccaccttcatcaacatgtctcaggagaatgtggacatg
agggattcttacctgggttactccaccgagctggctctctggaaaggggtgcagaacctg
gtcctgggggccccccgctaccagcacaccgggaaggctgccatcttcacccaggtgtcc
gggcagtggaggctgaaggccgaagtcacggggacgcagattggttcctacttcggggcc
tccctctgctctgtggatgtggacggcgatggcagcactgacctgatcctcatcggggcc
ccccattactacgagcagacccgagggggccaggtgtccgtgtgtcccttgcccaggggg
tggagaaggtggtggtgtgatgctgttctccacggggagcagggccacccctggggtcgc
tttggggcggctctgacagtgctgggggatgtgaatggggacaagctgacggacgtggtc
atcggggccccaggagaggaagagaaccagggtgctgtctacctgtttcatggagccttg
ggacttagcatcggcccctcccacagccagcggatcgccggctcccagctctcccccagg
ctgcagtattttgggcaggcactcagcgggggtcaagacctcacccaggatggactggtg
gacctagctgtgggggcccggggccaggcgctcctgctcaggacgagacctgtgctctgg
gtgcaggtgagcattcagttcaaacctgcggagatccccaggtctgcatttgagtgtcgc
gagcagatggtctctgaccagatcctgggacagtccagcatctgcctttacattgacaaa
cgttccaagaacctgcttgggagccatgacctccaaagctctctgaccgtggacctggct
ctcgaccctggccgcctgagtccccgtgccaccttccaggaaacaaagaaccggagtctg
agccgagtccaagtcctcgggctggagacatactgtgaaaccttcaccctgctgctcccg
acctgcgtggaggactctgtgacccccatcaccttgcgtctgaacttcacgctggtgggc
gagcccctccctgccttcagaaacctgcggcctatgctggccgccgatgctcagagatac
ttcatggcctccctcccctttgagaagaactgtggagccgaccatatctgccaggacgat
ctcggcatctccttcagcttcccaggcctgaagaccctgctggtggggagtaacctggag
ttgaacgcagaagtgatggtgtggaatgacggggaagactcctacggaaccaccatcacc
ttctcccacccggcaggactgtcctaccgccacgtggcagagggccagaaacaggggcag
ctgcgttccctgcgcctgacatgtgacagcgccccagttggaagccagggcacctggact
accagctgcagaatcaaccacctcatcttccgtggtggcgcccagatcaccttcttggct
acctttgacgtctcccccaaggctgtcctgggagaccggctgcttctgacagccaatgta
agcagtgagaacaacacccccaggacgaacaagaccaccttccagctggcgctcccgctg
aagtatgccgtctacactgtggctagcagccacgaacaatccaccaagtacctcaacttc
tcagactctgaggagaaggagaaccatgtggccgtgcaccgataccaggttaataacctg
ggacagagggacctgcctgtcagcatcaacttctgggtgcctgtggagctgaaccaggag
gctgtgtggatggaggtggaggtctcccacccccagaacccatcccttcggtgctcctca
gagaaaattgcatccccagcgtctgacttcctggcacacattcagaagaatcccgtgctg
gactgctccattgctggctgcctgcggttccgctgtgacatcccctccttcagcgtccag
gaggagctgcatttcaccctgaagggcaacctcagttttggctgggtccgccagacatca
cagaagaaggtgtcggttgtgagtgtggctgaaattacgttcgacacatccgtgtactcc
cagcttccaggacaggaggcatttatgagagctcagacgacaacggtgctggagaagtac
gaggtccacaaccccacccccctcatcgtaggcagctccattgggggtctgctgctgctg
gcgctcatcacagcagcactgtacaaagttggcttcttcaagcgtcagtacaagcaaatg
atggaggaggcaaatggacaaattgctccagaaaacgggacatag

DBGET integrated database retrieval system