KEGG   Macrococcus caseolyticus: MCCL_1123
Entry
MCCL_1123         CDS       T00848                                 
Symbol
hepB1
Name
(GenBank) component A of hexaprenyl diphosphate synthase
  KO
K21274  hexaprenyl-diphosphate synthase small subunit [EC:2.5.1.83]
Organism
mcl  Macrococcus caseolyticus
Pathway
mcl00900  Terpenoid backbone biosynthesis
mcl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mcl00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MCCL_1123 (hepB1)
Enzymes [BR:mcl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.83  hexaprenyl diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     MCCL_1123 (hepB1)
SSDB
Motif
Pfam: DUF5398
Other DBs
NCBI-ProteinID: BAH17830
UniProt: B9E6L2
LinkDB
Position
complement(1231260..1231697)
AA seq 145 aa
MAMKYLVNLENQIKELKKRYTYFQMINFEQEIIDIVSNLKVDDNVKSAIVVIDTSMRMQS
IINDGNKDRLVLSTDILSALFYRYLSQPFLQDDFKVLTRCVTRINELKELRLTITEQDRL
IEIDQEIHYMFVQPYMNDEKVVAYE
NT seq 438 nt   +upstreamnt  +downstreamnt
atggcaatgaaatatttagttaacctagaaaatcagattaaagagctaaaaaaacgatat
acttattttcagatgatcaactttgagcaggaaatcatcgatattgtcagcaatcttaaa
gtagatgacaatgtcaaaagtgcaatcgttgttattgatacaagtatgcgtatgcaaagt
ataatcaatgacggtaataaggacaggctcgtgctatctaccgacatattaagtgcatta
ttttatcgctatttatcacagccgtttttacaagatgactttaaagttttaacgcgatgt
gtcacgcgtattaatgaattgaaagaattgcgattaaccataactgaacaagatagatta
atagaaatagatcaggaaattcattatatgtttgtacaaccttatatgaatgatgagaaa
gtggtggcttatgagtaa

DBGET integrated database retrieval system