KEGG   Mastomys coucha (southern multimammate mouse): 116095669
Entry
116095669         CDS       T07224                                 
Symbol
Tnfrsf8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
mcoc  Mastomys coucha (southern multimammate mouse)
Pathway
mcoc04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:mcoc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    116095669 (Tnfrsf8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcoc04050]
    116095669 (Tnfrsf8)
   04090 CD molecules [BR:mcoc04090]
    116095669 (Tnfrsf8)
Cytokine receptors [BR:mcoc04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   116095669 (Tnfrsf8)
CD molecules [BR:mcoc04090]
 Proteins
  116095669 (Tnfrsf8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 116095669
NCBI-ProteinID: XP_031232845
LinkDB
Position
Unknown
AA seq 497 aa
MSALLMAAGLLFLGMLQAFPTDRPLKTTCARDLSYYPGEAARNNCYQCPSGLSPTQPCPQ
GPAHCRKQCAPDYYINEDGKCTACVTCLPGLVEKAPCSGTSPRICECQPGMYCCTPAVNS
CARCKLRCSEEEVVKFPGTAEKETICELPSPGSGPNCSDPDGCKTLASHATPQATPTLEP
TANDSVRSLLPKGVTNLVQEGAAKLVKVPESSSSKARKPSLDPGDTEKNMTLELPPPGTL
PDISTSENIGEPASTASTLSLLVDTQTSSRMQPTSPLSTGTPFLDPGPVLFWVAMVVLLV
GSGSFLLCYWKACRRRIQQKVHQDYLVQTSQPKTEQADSCPTEKLTQLQRSGSVTDPSAG
HKLSPVSPPTVETCANGEAACLESLPLLDDSTAGNPFSPREPPEPRVSTEHTNNRIEKIY
IMKADTVIVGSVKTEIPEGRAPAGSTESELEAELEMDHAPHYPEQETEPPLGSCTEVMFS
VEEGGKEDHGPTTVSEK
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgagcgccctactcatggcagcggggttgctgttcctggggatgcttcaagccttccca
acggatcgaccactaaagaccacctgtgccagagacctcagctactacccgggggaggct
gccaggaacaactgttaccagtgcccctcagggttgtctccaacacagccatgcccacag
ggtcccgcccactgcaggaagcagtgcgctcctgactactacatcaatgaagatgggaag
tgcactgcctgcgtgacctgtttgccaggtcttgtggagaaggctccatgttctgggacc
tctcctcggatctgtgaatgtcagcctggtatgtactgctgcacgccagcggtcaattcc
tgtgcccgctgcaaactccgctgttctgaagaagaggtggtcaagtttccaggcacagca
gagaaggaaactatctgtgagctgccgtccccgggatctggccccaactgctccgatcca
gatggctgcaagacacttgctagccacgccactcctcaggccacgcctactctagaaccc
acagccaatgacagtgtgaggagcctgctgccaaagggggtcaccaaccttgttcaggaa
ggtgctgctaagctggtgaaggttccagagtcttcgtcttccaaggcaaggaagcccagt
ctagatccaggtgatacagagaagaatatgaccttggagcttccacctccaggaacactc
cctgacatcagcacctcagaaaacatcggggagcctgccagtaccgcctccaccctaagc
cttttggtagatacccagaccagcagcaggatgcagcccacctctcccttgtccacagga
acaccatttctggatccaggacccgtgctcttctgggtggccatggtggtgctgctggtt
ggctctggctccttcctcctgtgttactggaaggcctgcaggaggcgaatccagcagaag
gttcaccaggactacctagtgcagacctcccagcccaagacagagcaggcggattcctgt
cctactgaaaagctaacacagctgcagagaagtgggtcagtgacagatcccagcgctgga
cacaagctgagcccagtgagccctccaactgttgagacttgtgccaatggtgaggccgcc
tgcctggagagcctgccgctgctggatgacagcacagctgggaatcctttttctcccagg
gaacctccagagccccgggtatccacggaacacaccaataacaggattgagaaaatctac
atcatgaaggccgacacagtgattgtgggctctgtcaaaactgaaatccctgagggccgg
gctccagcagggtcgacagagtctgagttggaagctgaactagaaatggaccatgccccc
cattacccggagcaggagacagaaccgcctctgggaagctgcactgaggtcatgttctcg
gtggaggaaggaggaaaagaggaccatgggcccacaactgtctctgagaagtga

DBGET integrated database retrieval system