KEGG   Mycobacterium crocinum: MI149_00710
Entry
MI149_00710       CDS       T08227                                 
Name
(GenBank) Rieske 2Fe-2S domain-containing protein
  KO
K11943  PAH dioxygenase large subunit [EC:1.13.11.-]
Organism
mcro  Mycobacterium crocinum
Pathway
mcro00624  Polycyclic aromatic hydrocarbon degradation
mcro01100  Metabolic pathways
mcro01120  Microbial metabolism in diverse environments
mcro01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mcro00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    MI149_00710
Enzymes [BR:mcro01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-
     MI149_00710
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: ULN41709
LinkDB
Position
130723..132090
AA seq 455 aa
MTTETTGTADATDPYLRRALRDVADGLKVGRLPARVVSDPALHTIEMERIFGRAWVFLGH
ESELAKSGDFVVRHIGADSVIVCRDNSGRIQALSNSCRHRGALVCRAEMGNTAHFQCPYH
GWVYSNTGELVGVPAMSEAYPGGFDKSQWGLRHIPHVDSYAGFIFGSVDPKAPSLTDYLG
DTTFYLDLIAKKTAGGLEVIGAPHRWVMSANWKTAADNFVGDSYHTLFAHRSMVELGMAP
GDPNFASAPAEISLQNGHGVGVLGFPPTLADFPEYEGYPDEVVDQMATSYPSPVHKDLMR
RSSFIHGTVFPNLSFINVTLAQDHMSPPTPFITFRVWHPLSHDRMEILSWFLVERDAPEW
LRDASQASYVNNFGPGGVFEQDDAEAWKAITESVQGPFAGEGLLNYEMGMDLTPLTDWPG
PGEALPSGYAEQNQRRFWGRWLEYMGQPPAFGGRA
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgaccaccgaaacaaccggaacagctgacgcgaccgatccctacctgcggcgcgcgctg
cgcgacgtagcggacgggctcaaggtcgggcgcttaccggcccgcgtcgtcagcgatccc
gcgctacacacgatcgagatggagcggatcttcgggcgcgcctgggtgtttctcggacac
gagtcggagttggccaagtccggcgacttcgtcgtgcggcacatcggggccgattcggtg
atcgtttgccgggacaactccggccgcatccaggcgctgtccaattcttgtcgccaccgt
ggtgcgctcgtgtgccgcgctgagatgggaaacaccgcgcacttccaatgcccgtaccac
ggctgggtgtacagcaacaccggagagctcgtcggcgtgccggcgatgagtgaggcctat
cccggcggcttcgacaagtcgcagtggggattacgtcacatcccccatgtcgactcgtac
gccggattcatcttcggcagcgtcgatccgaaggcgccgagcctgaccgactacctcggc
gacacgacgttctacctcgacctcattgcgaagaagacagcgggcggtctggaggtgata
ggggcaccgcatcgatgggtgatgtcagcgaactggaagacagccgccgacaattttgtc
ggcgactcctaccacaccctctttgctcaccgctcgatggtcgagctaggcatggcgccc
ggtgacccaaacttcgcgagcgcaccagcggaaatctcgctgcagaacggccacggcgtc
ggcgtactcggctttccgcccacgctcgccgattttcccgagtacgagggataccccgac
gaagtcgtcgaccagatggcgacgtcctacccgtcgccggtacacaaggacctgatgcga
cgctcatcctttattcacggcaccgtgttcccgaatttgtcgttcatcaacgtgaccctc
gcgcaggaccacatgtcgccccctacccccttcatcacgttccgggtatggcatccgctc
tcccatgatcggatggagatcctctcctggttcctggtcgaacgcgatgctccggaatgg
ttgcgcgatgcgtcccaggcgtcctacgtcaacaacttcggcccaggtggggttttcgaa
caggacgacgccgaggcatggaaggccatcaccgaatctgtccagggcccgttcgccggt
gaaggcctgctgaactacgaaatgggcatggacttgactccgctcaccgactggccaggg
ccgggagaggccctcccgagcgggtacgccgagcagaatcagcggcggttttgggggaga
tggctggaatacatgggtcagcctcccgcattcggcgggcgtgcttga

DBGET integrated database retrieval system