Musca domestica (house fly): 105262243 Help Entry 105262243         CDS       T03448                                  Name (RefSeq) probable insulin-like peptide 5   KO K04526   insulin Organism mde  Musca domestica (house fly) Pathway mde04068   FoxO signaling pathway mde04081   Hormone signaling mde04140   Autophagy - animal mde04150   mTOR signaling pathway mde04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:mde00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     105262243    04150 mTOR signaling pathway     105262243   09133 Signaling molecules and interaction    04081 Hormone signaling     105262243  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105262243  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     105262243  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mde04052]     105262243 Cytokines and neuropeptides [BR:mde04052]  Neuropeptides   Unclassified    105262243 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  105262243 NCBI-ProteinID:  XP_011295054 UniProt:  A0A1I8NJJ7 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MKLLYFIIGCVALYKCVAQLQTRVCGPSLSQLLQTVCENGFNPKFDKKSNVPPYLFISKL SKRSGKEPLQPLFADMLFNKRPSAVASARQERIYSGVYDECCRKTCSFNEIVDYCL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgaaacttctatattttataataggctgtgtcgcgttgtataagtgtgtggctcaattg caaacccgtgtctgtggaccaagtttatcgcaacttttgcaaactgtctgcgaaaatggc ttcaatccgaaattcgacaaaaaatccaatgtgcccccttatctcttcatttcaaaactg tctaagagaagtggcaaagaaccactacaaccactttttgccgatatgctattcaataaa cgacccagtgcagttgccagtgctcgtcaagaacgtatatattccggtgtttatgatgaa tgttgtcgcaaaacgtgcagctttaatgaaattgttgactattgcttatag

DBGET integrated database retrieval system