Methylomonas denitrificans: JT25_013070 Help Entry JT25_013070       CDS       T04191                                  Name (GenBank) ATP F0F1 synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism mdn  Methylomonas denitrificans Pathway mdn00190   Oxidative phosphorylation mdn01100   Metabolic pathways Module mdn_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:mdn00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     JT25_013070  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:mdn00194]     JT25_013070 Photosynthesis proteins [BR:mdn00194]  Photosystem and electron transport system   F-type ATPase [OT]    JT25_013070 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C MnhB Motif Other DBs NCBI-ProteinID:  AMK77399 UniProt:  A0A126T5N7 LinkDB All DBs Position 2839307..2839573 Genome browser AA seq 88 aa AA seqDB search MNDIHLFSIISTGVAGLVIALGTMLPALAMGKAIAAALEALARQPEAEKTITRTLFIGLA MIESLAIYCLVVALIVLFRNPLLEYFLK NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgaacgacatccatttattcagcataatttccaccggcgtggccgggctggtcattgcc ctcggtacgatgctgcccgctctggcgatggggaaggccattgccgccgcgctggaagcc ctggcccgtcagcctgaagccgagaaaaccatcacccgtaccttgttcatcggtctggcg atgatagagtcgctggcgatttactgtttggtggtggccttgattgtgctgtttagaaat ccattgcttgagtattttctaaagtaa

DBGET integrated database retrieval system