KEGG   Monodelphis domestica (gray short-tailed opossum): 100026482
Entry
100026482         CDS       T01031                                 
Symbol
RIMKLA
Name
(RefSeq) ribosomal modification protein rimK like family member A
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
mdo  Monodelphis domestica (gray short-tailed opossum)
Pathway
mdo00250  Alanine, aspartate and glutamate metabolism
mdo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100026482 (RIMKLA)
Enzymes [BR:mdo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     100026482 (RIMKLA)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     100026482 (RIMKLA)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 Dala_Dala_lig_C CPSase_L_D2 ATP-grasp Synapsin_C Rimk_N LIDHydrolase TTL
Other DBs
NCBI-GeneID: 100026482
NCBI-ProteinID: XP_001367054
Ensembl: ENSMODG00000017315
UniProt: F6XCL7
LinkDB
Position
4:428843247..428908969
AA seq 391 aa
MCSSLWFLTDRRIREDYPQVQILRALRQRCSEQDVRFRAVLMDQIAVTVVGGHLGLQVNQ
KALTTFPDVVLVRVPTPSVQSDSDITVLRHLEKLGCRLVNRPQSILNCINKFWTFQELAG
HGVPMPDTFSYGGHEDFAKMIDEAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLV
RHDVPYLFQKYVKESHGKDIRVVVVGGHVIGSMLRCSTDGRMQSNCSLGGVGVMCPLTEQ
GKQLAIQVSNILGMDFCGIDLLIMDDGSFVVCEANANVGFVAFDQACNLDVGGIIADYTM
SLLPRRLTGKMALLPGVSSAVEKSEPEGPASAQAGPESIYITNGGSTSSESEPELGEIRD
SLANTARAQPPSLPGPSYNINNMIASELKLK
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgtgctccagcctctggttcctgactgaccgaaggattcgtgaggactacccgcaggtg
cagatactgcgcgccctccggcagcgctgctccgaacaggacgtgcgcttcagggccgta
ctcatggaccagatcgccgtcaccgtcgtcggcggccacctcggcttgcaggtgaaccag
aaggctttgacaacattcccagatgtggtccttgtacgggtgcccacaccttcggtgcag
tcggacagtgacatcactgtcttgagacacctggagaagctaggctgccgcctggtcaac
cgcccccagagcattctgaactgcatcaacaagttttggacattccaagagctggctgga
catggggtccccatgccagacacgttttcctacggcggtcatgaagactttgccaagatg
attgatgaagctgagcccctggggtaccctgtggtggtgaagagtactcgaggacatcga
ggaaaagccgttttcctcgccagagataaacatcatttatcagacatctgccacctggtc
cgtcacgatgttccctacctgttccagaaatatgtgaaggaatctcacggcaaggatatc
cgtgtggtggtggtgggcggccacgtcattggctccatgctccgctgctccaccgacggg
cggatgcagagtaactgctccttaggcggtgtgggtgtcatgtgtccactcactgagcaa
ggcaaacagctggccattcaggtgtccaacatcttgggcatggatttctgcgggattgac
cttctcatcatggatgatggctcctttgtggtgtgcgaggcaaatgccaacgtgggcttt
gtggcattcgaccaggcgtgcaacctagatgtgggggggatcatcgctgactacaccatg
tccctgctcccccgccggctgaccgggaagatggcccttctcccaggagtgtctagcgct
gtggagaagagcgagcctgaaggacctgcctctgcccaggctggcccagaaagcatttac
atcaccaatggtggctctacatccagtgagagcgaaccagagctgggagaaatcagggat
tctttggcaaacacggccagggcccaacccccttcactgccaggccccagctacaatatt
aacaacatgattgcctctgaattaaaacttaaatga

DBGET integrated database retrieval system