KEGG   Monodelphis domestica (gray short-tailed opossum): 100027217
Entry
100027217         CDS       T01031                                 
Symbol
MRAP
Name
(RefSeq) melanocortin 2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
mdo  Monodelphis domestica (gray short-tailed opossum)
Pathway
mdo04927  Cortisol synthesis and secretion
mdo04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    100027217 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100027217 (MRAP)
SSDB
Motif
Pfam: MRAP DUF420 FixQ
Other DBs
NCBI-GeneID: 100027217
NCBI-ProteinID: XP_001377574
UniProt: A0A5F8GHV7
LinkDB
Position
4:complement(15863569..15882518)
AA seq 167 aa
MANRTNSTHSYYSYEYYMDYVDLPQVDERKLKANKYSIVIAFWVSLAAFVVLLFLILLYM
SWSGSVPIRGARSHRKCPWNYINFLFFIQKARSHQNSPTSPLQSQGQIKELEDGSSGNEQ
SQGNNCTPEPVLINDGNPFPENASHKALVVQVDSTVEKQARDPPYQS
NT seq 504 nt   +upstreamnt  +downstreamnt
atggcaaacagaactaactccacacattcttactacagctatgaatactacatggactac
gtggatcttccacaagtagatgaaaggaagttgaaggcgaacaaatattcaatcgtcatt
gctttttgggtcagccttgcagcatttgtggtgcttctcttcctaattttgctctatatg
tcctggtctggctcagttccaataaggggtgcccgttcacaccgtaaatgcccatggaat
tacatcaacttcctcttcttcatccagaaggccagaagtcatcaaaacagtcccacgagc
cccttgcagtctcagggtcaaatcaaagaactagaagatggcagttctggcaatgagcaa
tcacagggcaataattgtaccccagaacctgttctaatcaatgatggtaatcctttccca
gaaaatgcatctcataaagccctggtggttcaagttgatagcacagttgaaaaacaagca
agagatcccccctaccaaagctga

DBGET integrated database retrieval system