KEGG   Methylomonas sp. LL1: IVG45_20365
Entry
IVG45_20365       CDS       T07814                                 
Name
(GenBank) acylneuraminate cytidylyltransferase family protein
  KO
K24307  5-N-acetyl-7-N-(D-alanyl)-legionaminic acid cytidylyltransferase
Organism
mell  Methylomonas sp. LL1
Pathway
mell00541  O-Antigen nucleotide sugar biosynthesis
mell01100  Metabolic pathways
mell01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:mell00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    IVG45_20365
SSDB
Motif
Pfam: CTP_transf_3 NTP_transf_3 IspD
Other DBs
NCBI-ProteinID: QPK63130
UniProt: A0A7T0NXY2
LinkDB
Position
4350821..4351519
AA seq 232 aa
MKIIAFIPARKGSKRLADKNIKPLAGKPLIAWTIEAALAAGSNMDVIVSTDSPEIEGIAK
AYGAEVPFLRPESLAGDNIPTFDALEYTLDRLKKAGREYDTAVLLQPTSPLRKANHIAEA
LKLLEQPDVRSVVSVSEFEHPVEWTMPLPENRRLDSYISEHEQVLRTRSQDLPKRYRLNG
AVYCARTADILQYKSFYMPQGTCAYIMDKVFATDIDDLFDFEYAEFLISKGK
NT seq 699 nt   +upstreamnt  +downstreamnt
atgaaaatcatcgcattcataccggctcgtaaaggaagcaagcggctggcggataaaaat
atcaagccgcttgccggcaaacccttgattgcctggacgattgaggcggcattggcggct
gggtcgaatatggatgtgattgtgtctaccgattcccctgaaatcgagggcatagccaaa
gcttacggcgccgaagtgcctttcttgagacccgagagtctggcgggcgacaatatccct
accttcgatgctttggaatataccttggaccgtttgaagaaagccggcagagagtacgat
acggccgtgttgttgcaaccaacctctccgctacgcaaggcaaaccatatagccgaggcg
ttgaagctgctggagcaaccggatgtgcgctcggtagtatcggtgtcggagtttgagcat
ccggtcgaatggacgatgcctttgccggaaaatcgccgactggatagctatatttcggag
catgaacaagtcctaaggacccggagtcaggatttgcccaaacgctatcgattgaatggc
gccgtttattgcgccagaaccgccgatattttgcaatacaagagcttttatatgccgcaa
gggacctgtgcctatatcatggataaggtgtttgcgaccgatatcgacgatttgttcgat
tttgaatatgcggaatttttaattagcaagggtaaatga

DBGET integrated database retrieval system