KEGG   Macrococcus epidermidis: KFV12_07720
Entry
KFV12_07720       CDS       T08412                                 
Name
(GenBank) hypothetical protein
  KO
K21274  hexaprenyl-diphosphate synthase small subunit [EC:2.5.1.83]
Organism
mepi  Macrococcus epidermidis
Pathway
mepi00900  Terpenoid backbone biosynthesis
mepi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mepi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KFV12_07720
Enzymes [BR:mepi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.83  hexaprenyl diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     KFV12_07720
SSDB
Motif
Pfam: HEPPP_synt_1
Other DBs
NCBI-ProteinID: UTH15211
LinkDB
Position
complement(1463351..1463746)
AA seq 131 aa
MSFYERFLNDIDQLKKRYPFFEMIQVNQDILAQTKLLDLDDQTKCAILAIDTSMRMQDMV
DDSNKDRYVLSTDLLSALFYRYLASPFQQTQYQVLTECVARQNELKQQYSQSNDPAVKEK
IDNIFVMPFMA
NT seq 396 nt   +upstreamnt  +downstreamnt
atgagcttttatgaaagattcctaaacgatattgaccaattaaagaagcgatatcccttt
ttcgaaatgatacaagtcaaccaggatatattagcacaaacgaaattgttagatcttgat
gatcagacgaaatgtgcgatacttgcgattgacacaagtatgcgcatgcaggatatggtg
gatgatagcaataaagatcgatatgtgctctcaaccgatttattaagtgcattattctat
cgttatttagcatcacctttccaacaaacgcaatatcaggtacttactgaatgtgttgca
agacaaaatgaacttaagcaacaatattcgcagtcaaatgatcctgcagtgaaagaaaaa
atcgataatatttttgtaatgccttttatggcttaa

DBGET integrated database retrieval system