Mesorhizobium sp. Pch-S: C1M53_01715 Help Entry C1M53_01715       CDS       T05918                                  Name (GenBank) hypothetical protein   KO K03048   DNA-directed RNA polymerase subunit delta Organism mesp  Mesorhizobium sp. Pch-S Pathway mesp03020   RNA polymerase Brite KEGG Orthology (KO) [BR:mesp00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     C1M53_01715  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:mesp03021]     C1M53_01715    03400 DNA repair and recombination proteins [BR:mesp03400]     C1M53_01715 Transcription machinery [BR:mesp03021]  Prokaryotic type   Bacterial type    RNA polymerase     Core subunits      C1M53_01715 DNA repair and recombination proteins [BR:mesp03400]  Prokaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase complex (RNAP)       C1M53_01715 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  QAZ41875 UniProt:  A0A4P6H186 LinkDB All DBs Position complement(368722..369012) Genome browser AA seq 96 aa AA seqDB search MTFVAEPEMIEDTLASDEALLEATPEYELEARDDDEVVLSDDEDEQDDDGEGAEDDSDDE DESEDGDETAEDEDESEDGEETAEDDGEEDEAKAAA NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgacattcgttgccgaacccgaaatgattgaagacaccctggcctctgacgaggcgctg ctcgaagctacccctgaatacgaactcgaagctcgtgacgacgacgaggtcgtgctttcg gacgacgaagacgagcaggacgacgacggcgagggagccgaagacgattccgacgatgaa gacgagtccgaggatggcgatgaaaccgccgaggacgaagacgagtcggaagacggtgaa gagaccgccgaggacgacggcgaggaagacgaagccaaggccgcagcctga

DBGET integrated database retrieval system