Methylobacterium sp. DM1: C0214_02005 Help Entry C0214_02005       CDS       T05461                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism metd  Methylobacterium sp. DM1 Pathway metd01100   Metabolic pathways metd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:metd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C0214_02005   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C0214_02005 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF1493 TerB DUF5783 Motif Other DBs NCBI-ProteinID:  AWI87235 LinkDB All DBs Position 434674..434910 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVVEHLGVEPEKVTEASNFIDDLGADSLDTVELVMAFEEEFNVEIPDDAA ETIQTVGDAIKFLEKNSA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgccgagcgcgtgaagaagatcgtcgtcgagcatctgggcgtcgagcct gagaaggtcaccgaggcctccaacttcatcgacgatctcggcgccgacagcctcgacacc gtcgagctggtgatggcgttcgaggaggagttcaacgtcgagattccggacgacgcggcc gagaccatccagacggtcggcgacgcgatcaagttcctggagaagaactccgcctaa

DBGET integrated database retrieval system