Methylomonas sp. LW13: U737_07895 Help Entry U737_07895        CDS       T05879                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism metl  Methylomonas sp. LW13 Pathway metl02024   Quorum sensing metl03018   RNA degradation Brite KEGG Orthology (KO) [BR:metl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     U737_07895  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     U737_07895  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:metl03019]     U737_07895    03036 Chromosome and associated proteins [BR:metl03036]     U737_07895 Messenger RNA biogenesis [BR:metl03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      U737_07895 Chromosome and associated proteins [BR:metl03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     U737_07895 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  QBC26832 LinkDB All DBs Position 1735801..1736043 Genome browser AA seq 80 aa AA seqDB search MSKAQNLQDNFLNALRKEHTPVSIFLVNGIKLQGRVDSFDQYVVMLKNTVNQMVYKHAIS TIVPGKNVTMHRDPDVSDES NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtcgaaagcacaaaacttgcaggacaactttttgaatgccctcagaaaagaacacacc cccgtgtcgatttttttggttaacggtatcaaactgcaaggccgcgtcgattctttcgac caatacgtggtgatgctgaaaaacactgtgaatcagatggtttacaagcatgccatatcc actatcgttcccggcaaaaatgtcacgatgcaccgtgatcccgacgttagcgacgaaagc taa

DBGET integrated database retrieval system