KEGG   Methylobacterium sp. XJLW: A3862_11985
Entry
A3862_11985       CDS       T05508                                 

Definition
(GenBank) diacylglycerol kinase
  KO
K17364  dihydromethanopterin reductase [EC:1.5.1.47]
Organism
metx  Methylobacterium sp. XJLW
Pathway
metx00790  Folate biosynthesis
metx01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:metx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A3862_11985
Enzymes [BR:metx01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.47  dihydromethanopterin reductase [NAD(P)+]
     A3862_11985
SSDB
Motif
Pfam: DHFR_1 VWA_CoxE
Other DBs
NCBI-ProteinID: AWV16134
UniProt: A0A2U9TXC2
LinkDB
Position
2636762..2637172
AA seq 136 aa
MIDVRCICAIGLRGQLGLNGHLPWEGNTDPLFVEDVTRFFALTMGHVLIAGPKTVASVPE
FAFKDRTIDVIRSHEDPEEVLKRYPGRRIFVGGGIAVWNVYAKYIQNWDITRLPYDGEAD
RWFDPAWLVGGPLRAA
NT seq 411 nt   +upstreamnt  +downstreamnt
atgatcgacgtccgctgcatctgcgcgatcggcctgcggggccagctcggcctgaacggc
cacctcccctgggagggcaacaccgatccgctgttcgtggaagacgtgacgcgcttcttc
gcgctgaccatgggccacgtgctgatcgccgggccgaagaccgtggcctcggtccccgaa
ttcgccttcaaggaccgcaccatcgacgtgatccgcagccacgaggaccccgaagaggtg
ctcaagcgctatcccggccggcggatcttcgtcggcggcgggatcgcggtgtggaacgtc
tacgccaagtacatccagaactgggacatcacccgcctgccctacgacggcgaggccgac
cgctggttcgatcccgcctggctggtgggcggaccgctgcgcgcggcctga

DBGET integrated database retrieval system