KEGG   Alexandromys fortis (reed vole): 126515955
Entry
126515955         CDS       T08493                                 
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mfot  Alexandromys fortis (reed vole)
Pathway
mfot01521  EGFR tyrosine kinase inhibitor resistance
mfot01522  Endocrine resistance
mfot01524  Platinum drug resistance
mfot04010  MAPK signaling pathway
mfot04012  ErbB signaling pathway
mfot04014  Ras signaling pathway
mfot04015  Rap1 signaling pathway
mfot04022  cGMP-PKG signaling pathway
mfot04024  cAMP signaling pathway
mfot04062  Chemokine signaling pathway
mfot04066  HIF-1 signaling pathway
mfot04068  FoxO signaling pathway
mfot04071  Sphingolipid signaling pathway
mfot04072  Phospholipase D signaling pathway
mfot04114  Oocyte meiosis
mfot04140  Autophagy - animal
mfot04148  Efferocytosis
mfot04150  mTOR signaling pathway
mfot04151  PI3K-Akt signaling pathway
mfot04210  Apoptosis
mfot04218  Cellular senescence
mfot04261  Adrenergic signaling in cardiomyocytes
mfot04270  Vascular smooth muscle contraction
mfot04350  TGF-beta signaling pathway
mfot04360  Axon guidance
mfot04370  VEGF signaling pathway
mfot04371  Apelin signaling pathway
mfot04380  Osteoclast differentiation
mfot04510  Focal adhesion
mfot04517  IgSF CAM signaling
mfot04520  Adherens junction
mfot04540  Gap junction
mfot04550  Signaling pathways regulating pluripotency of stem cells
mfot04611  Platelet activation
mfot04613  Neutrophil extracellular trap formation
mfot04620  Toll-like receptor signaling pathway
mfot04621  NOD-like receptor signaling pathway
mfot04625  C-type lectin receptor signaling pathway
mfot04650  Natural killer cell mediated cytotoxicity
mfot04657  IL-17 signaling pathway
mfot04658  Th1 and Th2 cell differentiation
mfot04659  Th17 cell differentiation
mfot04660  T cell receptor signaling pathway
mfot04662  B cell receptor signaling pathway
mfot04664  Fc epsilon RI signaling pathway
mfot04666  Fc gamma R-mediated phagocytosis
mfot04668  TNF signaling pathway
mfot04713  Circadian entrainment
mfot04720  Long-term potentiation
mfot04722  Neurotrophin signaling pathway
mfot04723  Retrograde endocannabinoid signaling
mfot04724  Glutamatergic synapse
mfot04725  Cholinergic synapse
mfot04726  Serotonergic synapse
mfot04730  Long-term depression
mfot04810  Regulation of actin cytoskeleton
mfot04910  Insulin signaling pathway
mfot04912  GnRH signaling pathway
mfot04914  Progesterone-mediated oocyte maturation
mfot04915  Estrogen signaling pathway
mfot04916  Melanogenesis
mfot04917  Prolactin signaling pathway
mfot04919  Thyroid hormone signaling pathway
mfot04921  Oxytocin signaling pathway
mfot04926  Relaxin signaling pathway
mfot04928  Parathyroid hormone synthesis, secretion and action
mfot04929  GnRH secretion
mfot04930  Type II diabetes mellitus
mfot04933  AGE-RAGE signaling pathway in diabetic complications
mfot04934  Cushing syndrome
mfot04935  Growth hormone synthesis, secretion and action
mfot04960  Aldosterone-regulated sodium reabsorption
mfot05010  Alzheimer disease
mfot05020  Prion disease
mfot05022  Pathways of neurodegeneration - multiple diseases
mfot05034  Alcoholism
mfot05132  Salmonella infection
mfot05133  Pertussis
mfot05135  Yersinia infection
mfot05140  Leishmaniasis
mfot05142  Chagas disease
mfot05145  Toxoplasmosis
mfot05152  Tuberculosis
mfot05160  Hepatitis C
mfot05161  Hepatitis B
mfot05163  Human cytomegalovirus infection
mfot05164  Influenza A
mfot05165  Human papillomavirus infection
mfot05166  Human T-cell leukemia virus 1 infection
mfot05167  Kaposi sarcoma-associated herpesvirus infection
mfot05170  Human immunodeficiency virus 1 infection
mfot05171  Coronavirus disease - COVID-19
mfot05200  Pathways in cancer
mfot05203  Viral carcinogenesis
mfot05205  Proteoglycans in cancer
mfot05206  MicroRNAs in cancer
mfot05207  Chemical carcinogenesis - receptor activation
mfot05208  Chemical carcinogenesis - reactive oxygen species
mfot05210  Colorectal cancer
mfot05211  Renal cell carcinoma
mfot05212  Pancreatic cancer
mfot05213  Endometrial cancer
mfot05214  Glioma
mfot05215  Prostate cancer
mfot05216  Thyroid cancer
mfot05218  Melanoma
mfot05219  Bladder cancer
mfot05220  Chronic myeloid leukemia
mfot05221  Acute myeloid leukemia
mfot05223  Non-small cell lung cancer
mfot05224  Breast cancer
mfot05225  Hepatocellular carcinoma
mfot05226  Gastric cancer
mfot05230  Central carbon metabolism in cancer
mfot05231  Choline metabolism in cancer
mfot05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mfot05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mfot00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    126515955
   04012 ErbB signaling pathway
    126515955
   04014 Ras signaling pathway
    126515955
   04015 Rap1 signaling pathway
    126515955
   04350 TGF-beta signaling pathway
    126515955
   04370 VEGF signaling pathway
    126515955
   04371 Apelin signaling pathway
    126515955
   04668 TNF signaling pathway
    126515955
   04066 HIF-1 signaling pathway
    126515955
   04068 FoxO signaling pathway
    126515955
   04072 Phospholipase D signaling pathway
    126515955
   04071 Sphingolipid signaling pathway
    126515955
   04024 cAMP signaling pathway
    126515955
   04022 cGMP-PKG signaling pathway
    126515955
   04151 PI3K-Akt signaling pathway
    126515955
   04150 mTOR signaling pathway
    126515955
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    126515955
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    126515955
   04148 Efferocytosis
    126515955
  09143 Cell growth and death
   04114 Oocyte meiosis
    126515955
   04210 Apoptosis
    126515955
   04218 Cellular senescence
    126515955
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    126515955
   04520 Adherens junction
    126515955
   04540 Gap junction
    126515955
   04550 Signaling pathways regulating pluripotency of stem cells
    126515955
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    126515955
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    126515955
   04613 Neutrophil extracellular trap formation
    126515955
   04620 Toll-like receptor signaling pathway
    126515955
   04621 NOD-like receptor signaling pathway
    126515955
   04625 C-type lectin receptor signaling pathway
    126515955
   04650 Natural killer cell mediated cytotoxicity
    126515955
   04660 T cell receptor signaling pathway
    126515955
   04658 Th1 and Th2 cell differentiation
    126515955
   04659 Th17 cell differentiation
    126515955
   04657 IL-17 signaling pathway
    126515955
   04662 B cell receptor signaling pathway
    126515955
   04664 Fc epsilon RI signaling pathway
    126515955
   04666 Fc gamma R-mediated phagocytosis
    126515955
   04062 Chemokine signaling pathway
    126515955
  09152 Endocrine system
   04910 Insulin signaling pathway
    126515955
   04929 GnRH secretion
    126515955
   04912 GnRH signaling pathway
    126515955
   04915 Estrogen signaling pathway
    126515955
   04914 Progesterone-mediated oocyte maturation
    126515955
   04917 Prolactin signaling pathway
    126515955
   04921 Oxytocin signaling pathway
    126515955
   04926 Relaxin signaling pathway
    126515955
   04935 Growth hormone synthesis, secretion and action
    126515955
   04919 Thyroid hormone signaling pathway
    126515955
   04928 Parathyroid hormone synthesis, secretion and action
    126515955
   04916 Melanogenesis
    126515955
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    126515955
   04270 Vascular smooth muscle contraction
    126515955
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    126515955
  09156 Nervous system
   04724 Glutamatergic synapse
    126515955
   04725 Cholinergic synapse
    126515955
   04726 Serotonergic synapse
    126515955
   04720 Long-term potentiation
    126515955
   04730 Long-term depression
    126515955
   04723 Retrograde endocannabinoid signaling
    126515955
   04722 Neurotrophin signaling pathway
    126515955
  09158 Development and regeneration
   04360 Axon guidance
    126515955
   04380 Osteoclast differentiation
    126515955
  09159 Environmental adaptation
   04713 Circadian entrainment
    126515955
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    126515955
   05206 MicroRNAs in cancer
    126515955
   05205 Proteoglycans in cancer
    126515955
   05207 Chemical carcinogenesis - receptor activation
    126515955
   05208 Chemical carcinogenesis - reactive oxygen species
    126515955
   05203 Viral carcinogenesis
    126515955
   05230 Central carbon metabolism in cancer
    126515955
   05231 Choline metabolism in cancer
    126515955
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    126515955
  09162 Cancer: specific types
   05210 Colorectal cancer
    126515955
   05212 Pancreatic cancer
    126515955
   05225 Hepatocellular carcinoma
    126515955
   05226 Gastric cancer
    126515955
   05214 Glioma
    126515955
   05216 Thyroid cancer
    126515955
   05221 Acute myeloid leukemia
    126515955
   05220 Chronic myeloid leukemia
    126515955
   05218 Melanoma
    126515955
   05211 Renal cell carcinoma
    126515955
   05219 Bladder cancer
    126515955
   05215 Prostate cancer
    126515955
   05213 Endometrial cancer
    126515955
   05224 Breast cancer
    126515955
   05223 Non-small cell lung cancer
    126515955
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    126515955
   05170 Human immunodeficiency virus 1 infection
    126515955
   05161 Hepatitis B
    126515955
   05160 Hepatitis C
    126515955
   05171 Coronavirus disease - COVID-19
    126515955
   05164 Influenza A
    126515955
   05163 Human cytomegalovirus infection
    126515955
   05167 Kaposi sarcoma-associated herpesvirus infection
    126515955
   05165 Human papillomavirus infection
    126515955
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    126515955
   05135 Yersinia infection
    126515955
   05133 Pertussis
    126515955
   05152 Tuberculosis
    126515955
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    126515955
   05140 Leishmaniasis
    126515955
   05142 Chagas disease
    126515955
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    126515955
   05020 Prion disease
    126515955
   05022 Pathways of neurodegeneration - multiple diseases
    126515955
  09165 Substance dependence
   05034 Alcoholism
    126515955
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    126515955
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    126515955
   04933 AGE-RAGE signaling pathway in diabetic complications
    126515955
   04934 Cushing syndrome
    126515955
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    126515955
   01524 Platinum drug resistance
    126515955
   01522 Endocrine resistance
    126515955
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mfot01001]
    126515955
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mfot03036]
    126515955
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mfot04147]
    126515955
Enzymes [BR:mfot01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     126515955
Protein kinases [BR:mfot01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   126515955
Chromosome and associated proteins [BR:mfot03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     126515955
Exosome [BR:mfot04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   126515955
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 126515955
NCBI-ProteinID: XP_050021982
LinkDB
Position
Unknown
AA seq 379 aa
MAAAAAPGGGGGEPRGAAGVGPGVPGEVEVVKGQPFDVGPRYTQLQYIGEGAYGMVSSAY
DHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYI
VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERL
KELIFQETARFQPGASEAP
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggctccggggggcgggggcggggagccccggggagccgctggggtc
ggcccgggggtcccgggggaggtggaggtggtgaagggacagccattcgacgtgggccca
cgctacacgcagctgcagtacatcggcgagggcgcgtacggcatggtcagctctgcttat
gaccacgtgcgcaagactcgagtggccatcaagaagatcagccctttcgagcaccagacc
tactgccagcgtacactgagggagatccagatcttgctgcgattccgccatgagaatgtc
atcggcatccgagacatcctcagagcacccaccctggaagctatgagggatgtctacatt
gttcaggacctcatggagacagacctgtacaagctgctaaagagccagcagctgagcaac
gatcacatctgctacttcctctaccagatccttcggggcctcaagtatatccactcagct
aacgtgctccaccgggatctgaagccctccaacctgcttatcaacaccacctgcgacctt
aagatctgtgattttggcctggcccggatcgctgaccctgaacatgaccacaccggcttc
ctgacggagtatgtggccacacgctggtaccgagccccagagatcatgcttaactccaag
ggctacaccaaatccattgacatctggtctgtgggctgcattctggctgagatgctctcc
aaccggcccatcttccctggcaagcactacctggaccagctcaaccacattctaggtatc
ttgggctccccatcccaggaggaccttaattgtatcatcaacatgaaggcccgaaactat
ctacagtctctgccctcgaaaactaaggtggcttgggccaagcttttccccaaatctgac
tccaaagcacttgacctgctggaccggatgttaaccttcaaccccaacaagcgcatcact
gtagaggaagcgctggctcacccgtacctggaacagtactatgacccaacagatgagcca
gtggctgaggagcccttcacctttgacatggagctggatgatctccccaaggagcggctg
aaggaactgatcttccaagagacagcccgcttccagccaggggcctcagaggccccctaa

DBGET integrated database retrieval system