KEGG   Mycolicibacterium gilvum PYR-GCK: Mflv_0662
Entry
Mflv_0662         CDS       T00498                                 
Name
(GenBank) ring hydroxylating dioxygenase, alpha subunit
  KO
K11943  PAH dioxygenase large subunit [EC:1.13.11.-]
Organism
mgi  Mycolicibacterium gilvum PYR-GCK
Pathway
mgi00624  Polycyclic aromatic hydrocarbon degradation
mgi01100  Metabolic pathways
mgi01120  Microbial metabolism in diverse environments
mgi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mgi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mflv_0662
Enzymes [BR:mgi01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-
     Mflv_0662
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: ABP43151
UniProt: A4T599
LinkDB
Position
complement(683353..684720)
AA seq 455 aa
MTTETTGTADATDPYLRRALRDVADGLKVGRLPARVVSDPALHTIEMERIFGRAWVFLGH
ESELAKSGDFVVRHIGADSVIVCRDNSGRIQALSNSCRHRGALVCRAEMGNTAHFQCPYH
GWVYSNTGELVGVPAMTEAYPGGFDKSQWGLRHIPHVDSYAGFIFGSVDPKAPSLTDYLG
DTTFYLDLIAKKTAGGLEVIGAPHRWVMSANWKTAADNFVGDSYHTLFAHRSMVELGMAP
GDPNFASAPAEISLQNGHGVGVLGFPPTLADFPEYEGYPDEVVDQMATSYPSPVHKDLMR
RSSFIHGTVFPNLSFINVTLAQDHMSPPTPFITFRVWHPLSHDRMEILSWFLVERDAPEW
LRDASQASYVNNFGPGGVFEQDDAEAWKAITESVQGPFAGEGLLNYEMGMDLTPLTDWPG
PGEALPSGYAEQNQRRFWGRWLEYMGQPPAFGGRA
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgaccaccgaaacaaccggaacagctgacgcgaccgatccctacctgcggcgcgcgctg
cgcgacgtagcggacgggctcaaggtcgggcgcttaccggcccgcgtcgtcagcgatccc
gcgctacacacgatcgagatggagcggatcttcgggcgcgcctgggtgtttctcggacac
gagtcggagttggccaagtccggcgacttcgtcgtgcggcacatcggggccgattcggtg
atcgtttgccgggacaactccggccgcatccaggcgctgtccaattcttgtcgccaccgt
ggtgcgctcgtgtgccgcgctgagatgggaaacaccgcgcacttccaatgcccgtaccac
ggctgggtgtacagcaacaccggagagctcgtcggcgtgccggcgatgacggaggcctat
cccggcggcttcgacaagtcgcagtggggattacgtcacatcccccatgtcgactcgtac
gccggattcatcttcggcagcgtcgatccgaaggcgccgagcctgaccgactacctcggc
gacacgacgttctacctcgacctcattgcgaagaagacagcgggcggtctggaggtgata
ggggcaccgcatcgatgggtgatgtcagcgaactggaagacagccgccgacaattttgtc
ggcgactcctaccacaccctctttgctcaccgctcgatggtcgagctaggcatggcgccc
ggtgacccaaacttcgcgagcgcaccagcggaaatctcgctgcagaacggccacggcgtc
ggcgtactcggctttccgcccacgctcgccgattttcccgagtacgagggataccccgac
gaagtcgtcgaccagatggcgacgtcctacccgtcgccggtacacaaggacctgatgcga
cgctcatcctttattcacggcaccgtgttcccgaatttgtcgttcatcaacgtgaccctc
gcgcaggaccacatgtcgccccctacccccttcatcacgttccgggtatggcatccgctc
tcccatgatcggatggagatcctctcctggttcctggtcgaacgcgatgctccggaatgg
ttgcgcgatgcgtcccaggcgtcctacgtcaacaacttcggcccaggtggggttttcgaa
caggacgacgccgaggcatggaaggccatcaccgaatctgtccagggcccgttcgccggt
gaaggcctgctgaactacgaaatgggcatggacttgactccgctcaccgactggccaggg
ccgggagaggccctcccgagcgggtacgccgagcagaatcagcggcggttttgggggaga
tggctggaatacatgggtcagcctcccgcattcggcgggcgtgcttga

DBGET integrated database retrieval system