KEGG   Meleagris gallopavo (turkey): 100538396
Entry
100538396         CDS       T01523                                 

Symbol
RPA1
Name
(RefSeq) replication protein A 70 kDa DNA-binding subunit
  KO
K07466  replication factor A1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03030  DNA replication
mgp03420  Nucleotide excision repair
mgp03430  Mismatch repair
mgp03440  Homologous recombination
mgp03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100538396 (RPA1)
   03420 Nucleotide excision repair
    100538396 (RPA1)
   03430 Mismatch repair
    100538396 (RPA1)
   03440 Homologous recombination
    100538396 (RPA1)
   03460 Fanconi anemia pathway
    100538396 (RPA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mgp03000]
    100538396 (RPA1)
   03032 DNA replication proteins [BR:mgp03032]
    100538396 (RPA1)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100538396 (RPA1)
Transcription factors [BR:mgp03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    100538396 (RPA1)
DNA replication proteins [BR:mgp03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    100538396 (RPA1)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     100538396 (RPA1)
   MMR (mismatch excision repair)
     100538396 (RPA1)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     100538396 (RPA1)
SSDB
Motif
Pfam: Rep_fac-A_C REPA_OB_2 Rep-A_N tRNA_anti-codon DUF5521 DUF4939 IBR
Other DBs
NCBI-GeneID: 100538396
NCBI-ProteinID: XP_010720022
Ensembl: ENSMGAG00000005315
LinkDB
Position
21
AA seq 614 aa
MSGRLSEGAIAAIMQGENVCKPVLQVINTRAIATGNGPPRYRVLMSDGVNTLSSFMLATQ
LNPLVEEERLSAHCICQVNRFIVNSLKDGRRVVILMDLDVLKTADMVGGTVGNPVPYNEG
QGQQRSSAPTANTAPNKPQQQNGNLSVAGSAAPKYHAPSNQFSKASAPSSVKTPGGTQSK
VVPIASLNPYQSKWTICARVTQKGQIRTWSNSRGEGKLFSIELVDESGEIRATAFNDQAD
KFFPLIELNKVYYFTKGNLKTANKQYTAVKNDYEITFTNETSVVPCDDAQHLPSVQFDFV
SISDLENTPKDSIVDVIGICKSYEDVTKIVVKANNREVSKRNVHLMDTSGKLVTATLWGN
EAEKFDGSRQPVIAIKGARVSDFGGRSLSVMSSSTVVVNPDSPEAFKLRGWFDSEGQLLE
CASISDVRGGSASGVNTNWKTLYEAKSERLGQGDKADYFSCVGTIVHLRKENCMYQACPS
QDCNKKVIDQQNGLYRCEKCDREFPNFKYRMMLLVTIADSLDYQWVTCFQESAEFILGQS
ATFLGELKEKNEQAFEEVFQNANFNTYEFKIRVKLETYNDESRIKATALDVKPVNYREYS
KRLIASIRRNAQLG
NT seq 1845 nt   +upstreamnt  +downstreamnt
atgagcgggcgtctgagcgaaggcgccatcgcggccataatgcagggagagaacgtctgc
aagcccgtgctgcaagttattaacacacgggctatcgccacaggaaatgggcctcctcgg
taccgagtgctgatgagtgatggggtgaacacgctctcctcattcatgctggcaacacag
ctgaacccccttgtggaagaggaacgtttatcagcacactgtatttgccaggttaacaga
ttcattgtcaacagcttgaaagatggaaggagagtggttatactgatggatttagatgtc
ctgaaaactgctgatatggttggtgggactgttggcaacccagtgccttacaacgaaggg
cagggacagcaacgttcttcagctccaacagccaacacagcacccaacaagccacagcaa
cagaatggcaatttgtcagtagcaggttctgctgctccaaagtaccacgctccctcaaac
cagtttagtaaagccagtgctcccagctcagtgaagacaccagggggaacgcagtccaaa
gtagtgcccattgccagcttgaatccataccaatctaagtggaccatttgtgctcgtgtt
acccaaaaagggcagatccgcacatggagcaattcccgtggtgaagggaagctcttctct
atagagctggttgatgagagcggtgagattagagctacagcattcaatgatcaagcagac
aagttctttcctctcattgaactgaacaaggtatattattttaccaaaggcaatttgaag
actgctaacaagcaatatacagctgttaagaatgattatgagattacattcactaatgag
acttcggttgtgccctgtgatgatgcccagcatcttccatctgttcagtttgattttgta
tccatctctgacttggagaacacacccaaagactcaattgtcgatgtaattggaatttgt
aagagctatgaagatgtcactaaaattgtagtgaaagctaacaatagggaggtatcgaag
aggaatgtgcatctgatggatacatcagggaaactggtgacagctacgctatggggaaat
gaggctgagaagtttgatggttccagacaacctgtgatagccatcaaaggagcccgggtc
tctgattttggtggtagaagcctgtctgtcatgtcatcgagcacagtggttgtcaaccct
gatagcccagaggctttcaagctccgaggatggtttgactctgagggacagcttctggaa
tgtgcctccatctctgatgtgagaggtgggtcggcatcaggggtgaataccaactggaaa
actttgtatgaagccaaatcggagaggttgggacaaggagataaggcggattattttagc
tgtgtgggcacaatagtacatctgcgcaaagagaactgcatgtaccaggcctgtccctct
caggattgcaataagaaagtgatagaccaacagaatggactgtatcgttgtgagaagtgc
gaccgtgagttccccaacttcaagtaccgcatgatgctgctggtgaccattgcagactct
ctagattaccagtgggtgacttgcttccaagagtcagcagaattcattcttgggcaaagt
gctactttcctgggagagctgaaggagaagaacgagcaggcgtttgaagaagtctttcaa
aatgcaaatttcaacacgtatgagttcaagatcagagtaaaactggagacgtacaacgat
gaatctcgtattaaggctacagcactggacgtcaaacctgtaaactacagagaatacagc
aagaggttgatcgcgagcatcaggagaaatgctcagctaggatga

KEGG   Meleagris gallopavo (turkey): 100542097
Entry
100542097         CDS       T01523                                 

Symbol
RPA2
Name
(RefSeq) replication protein A 32 kDa subunit
  KO
K10739  replication factor A2
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03030  DNA replication
mgp03420  Nucleotide excision repair
mgp03430  Mismatch repair
mgp03440  Homologous recombination
mgp03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100542097 (RPA2)
   03420 Nucleotide excision repair
    100542097 (RPA2)
   03430 Mismatch repair
    100542097 (RPA2)
   03440 Homologous recombination
    100542097 (RPA2)
   03460 Fanconi anemia pathway
    100542097 (RPA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mgp03032]
    100542097 (RPA2)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100542097 (RPA2)
DNA replication proteins [BR:mgp03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    100542097 (RPA2)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     100542097 (RPA2)
   MMR (mismatch excision repair)
     100542097 (RPA2)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     100542097 (RPA2)
SSDB
Motif
Pfam: RPA_C tRNA_anti-codon TFA2_Winged_2 Stn1 LexA_DNA_bind
Other DBs
NCBI-GeneID: 100542097
NCBI-ProteinID: XP_003212533
Ensembl: ENSMGAG00000001131
UniProt: G1MQZ0
LinkDB
Position
25
AA seq 267 aa
MWGGHGNFDGGYGPAGGYTQSPGGFSSPTGAQAEKKQRSRSQSIVPCTVSQLLAAEQVDE
AFRIHDVEISQVTVVGIVRHAEKAPTNILYKVDDMTAAPMDVRQWVDTDEAGSENIVVPP
GTYVKVAGHLRSFQNKKSLVAFKIMPLENMNEFTTHILETVNAHMILRKNLMLASRAPQS
FTSAGMSDVGSYGGGSLPVNGLTAHQSQVLNLIKNCHSPEGMSLQELKLQLHNVSIPTIK
QAVEFLSSEGHIYSTVDDDHYKSTDAD
NT seq 804 nt   +upstreamnt  +downstreamnt
atgtggggcgggcacggtaacttcgacggtggctacggcccggcgggcggctacacgcag
tccccgggaggtttcagctctcctacaggcgcgcaggcggagaagaagcagcgcagccgc
tcgcagagcatcgtgccctgcaccgtgtcgcagctgctggcggccgagcaggtggacgag
gcgttccgcatccacgatgtggagatctcacaggtcaccgtggttggcatcgtaaggcac
gcagagaaggcgcccaccaacatcctgtacaaggtggacgacatgacagcagcacccatg
gatgtgcggcagtgggttgacaccgacgaggcaggtagtgagaatatcgtggtaccccca
ggaacttatgtaaaagtcgctggtcatcttcggtcttttcagaataagaaaagtttggtg
gcatttaagatcatgcctttggaaaacatgaatgagttcaccacgcacatacttgagaca
gtcaatgcacatatgatcctcagaaaaaatctgatgttagcatcaagagcacctcagtca
tttacctctgctggaatgagtgacgttgggagctacggtggaggcagcctgcctgtgaat
ggactcacagcacatcagagtcaggtgctgaacctgattaaaaactgccattctccagaa
ggtatgagtcttcaagagctgaaacttcagctccacaatgtcagcataccaacaatcaag
caagcagttgaattccttagcagtgagggacacatctactctactgtggatgatgatcac
tataagtctacggatgctgattga

KEGG   Meleagris gallopavo (turkey): 104915636
Entry
104915636         CDS       T01523                                 

Symbol
RPA3
Name
(RefSeq) replication protein A 14 kDa subunit
  KO
K10740  replication factor A3
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03030  DNA replication
mgp03420  Nucleotide excision repair
mgp03430  Mismatch repair
mgp03440  Homologous recombination
mgp03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    104915636 (RPA3)
   03420 Nucleotide excision repair
    104915636 (RPA3)
   03430 Mismatch repair
    104915636 (RPA3)
   03440 Homologous recombination
    104915636 (RPA3)
   03460 Fanconi anemia pathway
    104915636 (RPA3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mgp03032]
    104915636 (RPA3)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    104915636 (RPA3)
DNA replication proteins [BR:mgp03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    104915636 (RPA3)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     104915636 (RPA3)
   MMR (mismatch excision repair)
     104915636 (RPA3)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     104915636 (RPA3)
SSDB
Motif
Pfam: Rep_fac-A_3 Tcp10_C
Other DBs
NCBI-GeneID: 104915636
NCBI-ProteinID: XP_010724851
LinkDB
Position
Unknown
AA seq 70 aa
CFVGRVEKIHPTGKLIVLSDGEGCNATVELSEPLDEEISGILEVVGRVTNQATIMCMSYV
QFREDKSPFG
NT seq 212 nt   +upstreamnt  +downstreamnt
tgcttcgtggggcgcgtcgagaagattcacccgacgggaaaacttatcgttctgtcggac
ggagaaggctgcaacgcgacggtggagctgagcgaacctctagatgaagagatctcagga
attcttgaagtggtgggaagagtaacaaatcaggcaaccatcatgtgcatgtcatacgtc
cagttcagggaagataaaagtccatttggtaa

DBGET integrated database retrieval system