KEGG   Meleagris gallopavo (turkey): 100540164
Entry
100540164         CDS       T01523                                 

Gene name
PARP1
Definition
(RefSeq) poly [ADP-ribose] polymerase 1
  KO
K24070  poly [ADP-ribose] polymerase 1 [EC:2.4.2.30]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03410  Base excision repair
mgp04210  Apoptosis
mgp04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    100540164 (PARP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100540164 (PARP1)
   04217 Necroptosis
    100540164 (PARP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mgp03032]
    100540164 (PARP1)
   03036 Chromosome and associated proteins [BR:mgp03036]
    100540164 (PARP1)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100540164 (PARP1)
Enzymes [BR:mgp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     100540164 (PARP1)
DNA replication proteins [BR:mgp03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     100540164 (PARP1)
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    100540164 (PARP1)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     100540164 (PARP1)
SSDB
Motif
Pfam: PARP PARP_reg zf-PARP WGR PADR1 BRCT BRCT_2
Other DBs
NCBI-GeneID: 100540164
NCBI-ProteinID: XP_010704958
Ensembl: ENSMGAG00000007760
LinkDB
Position
2
AA seq 969 aa
MFDGKVPHWHHYSCFWKRARIVSHTDIDGFPELRWEDQEKIKKAIETGGPGGGKGGDQEG
GGKAEKSLTDFAAEYAKSNRSTCKGCEQKIEKGQIRISKKMVHPEKPQLGMIDNWYHPDC
FVSRRAELGFLPAYGATQLLGFSILKAEDKETLKKQLPAAKTEGKRKGEEVDGNVIAKKK
SKKEKEKESKQEKQLKEQTELIWGIKDELRKVCSTNDLKELLIANKQEVPSGENAILDRV
ADGMAFGALLPCEECKGQFVFKSDAYYCSGDITAWTKCVAKTQTPNRKDWVIPKEFREIP
YLKKFKCKKQDRIFPPEAATVNSVPPPSVSAPLTETVSTPQDKPLTNMKILTLGKLSKNK
EEVKNIVEELGGKMTTTANKATLCISTQKEVEKMSKKMEEVKDAKVRVVSEEFLKDVKSC
SKSFQELLSLHAISPWGAEVKTEHQEVAVDGKCSKPPNMKSAGKVKEEQGPSKSEKKMKL
TVKGGAAVDPDSGLEDSAHVFEKGGKIFSATLGLVDIVKGTNSYYKLQLLEDDRESRYWV
FRSWGRVGTVIGSNKLEQMPSKEDAVEHFLNLYEEKTGNSWHSKNFTKYPKKFYPLEIDY
GQDEEAVKKLTVGAGTKSKLAKPIQDLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQ
IQSAYSILNEVQQAVSDGGSESQILDLSNRFYTLIPHDFGMKKPPLLSNLEYIQAKVQML
DNLLDIEVAYSLLRGGNEDGDKDPIDINYEKLRTDIKVVDKDSEEAKIIKQYVKNTHAAT
HNAYDLKVVEIFRIEREGESQRYKPFKQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAP
VTGYMFGKGIYFADMVSKSANYCHTSQADPIGLILLGEVALGNMYELKNASHITKLPKGK
HSVKGLGKTAPDPTATTTLDGVEVPLGNGISTGINDTCLLYNEYIVYDVAQVNLKYLLKL
KFNYKTSLW
NT seq 2910 nt   +upstreamnt  +downstreamnt
atgtttgatggcaaagtccctcactggcaccactacagctgcttctggaagcgggcgcgg
atcgtgtcccacacggacatcgatggcttccctgagctccgctgggaggaccaggagaaa
atcaagaaggccattgaaactggaggccctggaggaggaaaaggaggggaccaggaagga
ggtggcaaggctgagaagagcctaactgactttgctgcagagtatgccaagtctaacagg
agtacttgcaaaggttgtgagcagaaaatagaaaagggccagattcggatttccaagaag
atggtgcatcccgaaaaaccacagctggggatgatcgataactggtaccacccggactgc
tttgtgagccgccgggcagagctgggcttcctcccagcatatggggccacccagctcctg
ggtttcagcatcttgaaagctgaagataaagaaactctgaagaagcaactaccggctgcc
aagactgaaggaaagagaaaaggagaagaggtagatggaaatgtgattgcaaaaaagaaa
tcaaaaaaagaaaaagaaaaagaatcaaagcaggaaaaacagctgaaggagcagacagag
ctgatctggggcatcaaggatgagctgaggaaggtctgctccaccaatgacctgaaagag
ctgctgattgccaacaagcaggaggtgccttcaggggagaatgcaattttggaccgagtg
gcagatgggatggcgtttggagctctgcttccctgcgaggaatgtaaggggcagtttgtg
ttcaagagcgatgcatactactgttcaggggacattactgcctggactaagtgtgtggct
aaaacacagactcccaacaggaaagactgggtaatcccaaaggaatttcgtgaaattcct
tatctcaaaaagtttaagtgtaagaagcaggacaggatattccctcctgaggctgcaact
gtgaactctgtgccacctccatctgtatctgctcctttgacagagactgtctctacaccc
caagacaaaccactgaccaacatgaagatcctgacccttggaaagctgtccaagaacaag
gaggaagtgaagaatattgtggaggagttgggaggaaaaatgacaacaacagctaacaag
gccaccctgtgcatcagcacacagaaggaggtggagaaaatgagcaagaagatggaagaa
gtgaaggatgccaaagttcgtgtggtctcagaggagtttcttaaggatgtgaaatcttgc
agcaagagctttcaggagcttctctctctccatgcaatttcaccttggggtgcagaggtg
aaaacggagcaccaggaggtggcggtggatgggaagtgcagcaagcccccaaatatgaag
agtgctgggaaggtcaaagaagaacaaggacctagcaagtctgaaaagaaaatgaagcta
acagttaaaggtggagcagcagtagatcctgactctggcttggaggattctgctcacgtc
tttgaaaaaggtggaaagattttcagtgcaactcttggcctagtagatattgtgaaagga
acaaattcctattacaaactgcagctgctagaggatgacagagagagcaggtactgggtg
ttcagatcctggggtcgtgtgggcactgtcattgggagtaacaagctggagcagatgcca
tcaaaagaagatgctgttgaacacttcctaaatttgtatgaagagaaaactggcaattct
tggcattcaaagaacttcactaaatatccaaaaaaattctacccactggaaatagattat
ggacaggatgaagaagctgtcaagaaactgacagtgggtgctgggactaaatcaaagctt
gctaagccaatccaagaccttattaagatgatttttgatgtggagagcatgaagaaagct
atggtggaatttgagatcgacctgcagaagatgccactggggaaactgagcaagcgacag
atccaaagtgcatactccatccttaatgaagttcagcaggcagtttctgatggtggttct
gaatcccagatcttggacctctcaaaccgtttctatactctgatccctcatgactttggg
atgaagaaaccacctcttctcagtaacttagaatatatccaggctaaagtgcagatgttg
gacaacttgcttgatattgaggttgcctacagtcttctcagaggtggaaatgaagatgga
gataaagacccaattgatatcaattatgaaaagcttcgaactgatattaaggtagttgac
aaagattcagaagaagccaagattattaaacaatatgtgaaaaatactcatgctgctact
cacaatgcatatgacctcaaagttgtggaaatcttcaggattgaacgtgaaggagagagt
cagcgttacaagccatttaagcagcttcataatcgccagctgctgtggcacggttcccgc
accaccaacttcgctggtatcctctcgcagggtctccggatagctccccctgaagctcct
gtgactggctacatgtttgggaaaggcatctactttgcagacatggtgtccaagagtgcc
aactactgtcacacatctcaagctgatccaattgggttaatactactgggagaagttgcc
cttggaaatatgtatgagctaaagaatgcttctcacataacaaaattgcccaaaggaaag
catagtgtgaaaggcttgggtaaaactgcacctgatcccacagccactacaacccttgat
ggtgtagaagttcccttagggaatgggatctcaacaggaattaatgatacctgtcttctg
tacaatgaatatattgtgtatgatgttgctcaggtaaatctgaagtacctgctgaaactg
aaattcaactataagacatcactctggtga

KEGG   Meleagris gallopavo (turkey): 100549659
Entry
100549659         CDS       T01523                                 

Gene name
PARP4
Definition
(RefSeq) LOW QUALITY PROTEIN: protein mono-ADP-ribosyltransferase PARP4
  KO
K10798  poly [ADP-ribose] polymerase 2/3/4 [EC:2.4.2.30]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03410  Base excision repair
mgp04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    100549659 (PARP4)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100549659 (PARP4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mgp03032]
    100549659 (PARP4)
   03036 Chromosome and associated proteins [BR:mgp03036]
    100549659 (PARP4)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100549659 (PARP4)
Enzymes [BR:mgp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     100549659 (PARP4)
DNA replication proteins [BR:mgp03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     100549659 (PARP4)
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    100549659 (PARP4)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     100549659 (PARP4)
SSDB
Motif
Pfam: VIT VWA_3 VWA VWA_2 VIT_2 VWA_CoxE
Other DBs
NCBI-GeneID: 100549659
NCBI-ProteinID: XP_019467816
Ensembl: ENSMGAG00000015136
LinkDB
Position
1
AA seq 959 aa
MFQTYTNQNSSPIEAKYVFPLDDKAAVCGFEAFVNGTHIIGQVKEKKQAHREYRKAISEG
DGAYLMDQDAPDIFVITVGNICPNSTVLIKVTYITELSCQNGCITFHMPASVSPWQQDKA
LNENTQDTVKKICIKQVETLKNRFSLDMSIEMPYSIESLHSWTHKLKIKKTECKAVIKTV
DNSSLDSSGFGLDIWISHAYVPRMWVEKHPNKNSEACMLVFQPEFEAAFDEEQLSSEIII
LLDCSNSMAGSALLQAKQIALHALKQLNSRQNVNVIKFGTNFSEFSSFSKDALKDLASLT
EFITSATATMGNTDLWKSLRYLSLLFPSQGHRNILLISDGHIQNESVTFQLVKDNVHHTR
LFTCGVGSAANRHMLRSLSQYGAGAFEYFDSKSKYNWEAKIQSQVSRIFSPGCSSVSIKW
QQFDINAPKPMQAPAQIQSLFTNERLLVYGFVPHCTQATLRAIINDQELQTVVSTTELQK
TTGTVLHKLTARAFIRDYEDGILHENETEHEMKKQILKNMIIHLSLENSIITQFTSFIAV
EKRDTNEICSANVPNILEIIAQEDVDFLPYMNWEQKPVGSSVSFSGEPYGMPPFDGDLQD
SEAWSDCFTAERCEAEGFQFRLGELSVNQESTSQEVTPQDYGFHDGDITTMKCSRIMSSL
PCKSSVNALLFGSGLEAGGEAYITQTNSLPTPALPDPGAHLRLCEPPIYCSPRSLFGGMK
YDNSSVDHIPNIIVFNSCTSTYSSHKTNAEKQVTHNSPAPQHSKKXKIKPKCRKKMVTGL
HDATASEQEFPESAKFLVQPRCFITTEKERSQQKLEFTPVIWEEIFDLQNQDGSWNLSPQ
LGKILKFDVDYLINHFLIRKGIQSLGTNGKEKLLKLIATLLVLQFIRCAKELQGIVFKSL
MKLDNLTTSSGVHWAFESIKKATEWVKRVEGQFASICYRLELGKDWDSATKKILGIECN
NT seq 2880 nt   +upstreamnt  +downstreamnt
atgtttcagacctacaccaatcaaaacagtagtccaattgaagctaagtatgtttttcct
ttggatgataaagctgctgtttgtggatttgaagcttttgtcaatggaacacacatcatt
gggcaggttaaagagaagaaacaagcgcatagagaatatcgcaaagctattagtgaaggt
gatggagcttatctaatggaccaggatgcaccggatatttttgtaataactgttggaaat
atatgtccaaactctacagtactgatcaaagttacctatatcactgaactgagttgccag
aacggttgtatcacctttcatatgcctgcttctgtgtccccatggcaacaggacaaagca
ttgaatgaaaacacacaggatacagtaaaaaagatttgtattaaacaagtagaaacactg
aaaaacagattctccttagatatgtctattgagatgccatatagcattgaaagcctacac
agttggacacataaacttaagataaagaaaacagaatgcaaggctgtaattaagaccgta
gacaacagttctttggacagtagtggctttggtctagatatatggatttctcatgcctat
gtgccccgaatgtgggtagagaagcatcccaacaaaaatagtgaggcttgcatgcttgta
ttccaaccagagttcgaagcagcatttgatgaagagcagctgtccagtgaaattattatt
ttattagattgctcaaattctatggcaggttcagctctattgcaagcaaagcagattgct
ttacatgccttaaaacagcttaattccagacaaaatgtaaatgtaatcaaatttggcaca
aatttctcagaattttcttcattttcaaaggatgccttaaaggatttggcatcactaact
gagtttattacatctgctacagcaacaatgggaaacactgatttatggaagagcttgcgt
tacttgagtttgctatttccttctcaaggacatcgtaacattcttcttatatccgatgga
cacattcagaatgagagtgtgaccttccagcttgtgaaagacaatgtccaccatacgagg
ttattcacatgtggtgttggttctgcagcaaatcgacacatgctgagatctttgtcccag
tatggtgctggagcatttgaatactttgactcaaaatcaaagtataactgggaggcaaag
atacagagccaagtgtctagaatattttctccaggatgcagttctgtttctattaaatgg
caacagtttgatataaatgcaccaaagccaatgcaggctcctgctcaaatacagtctttg
tttaccaatgagaggcttctcgtctatggatttgtccctcactgtactcaggccacctta
agggcgataataaatgaccaagaactacaaactgtggtgtcaactactgaattacagaag
acaacgggaacagtgctacacaaactcacagcaagagctttcattagggactatgaagat
ggtattcttcatgagaatgaaacagaacatgagatgaagaagcagatcttgaagaacatg
attatacatctcagtttggagaactcgattataacccagtttacaagcttcattgcagtt
gagaagagggatactaatgaaatttgttctgctaatgttccaaacatcctggaaattata
gctcaagaagatgttgattttttaccttatatgaactgggaacaaaagccagtgggatcc
agcgtctcattttcaggagaaccttacgggatgcctccatttgatggagatctgcaagat
tctgaagcttggtcagattgtttcacagctgagagatgtgaagctgaaggcttccaattt
cgacttggagaactttctgttaatcaagaaagcacctcacaagaagtcacaccacaggat
tatggatttcatgatggtgacatcacaacgatgaaatgttcaagaataatgtcatcttta
ccatgtaaatcttctgtgaatgctttattatttggctctggactagaagcaggaggagaa
gcttatataactcaaacaaattcacttccaacacctgcacttccagatccaggtgcccat
ctgagactttgtgaacctcccatttattgttctcctcgaagtctctttggaggaatgaaa
tatgataattcttctgttgatcacattccaaatataattgtgttcaattcatgtacaagc
acatactcttctcataagactaatgctgaaaaacaagttactcacaattctcctgctccc
caacatagtaaaaaannaaaaattaagccaaagtgtaggaagaaaatggtaacaggtctg
cacgatgctacagcttctgaacaagaatttcctgagagtgctaaatttttggtacaacca
aggtgtttcataacaacagagaaagaaagaagccaacagaaacttgagtttactcctgta
atctgggaagaaatttttgatctccaaaatcaggatggctcttggaatctcagtccacag
ttgggaaaaatcttgaaatttgatgttgattatttaattaatcatttccttattagaaaa
ggcattcagtcactcggcacaaatggaaaagaaaagctactgaagttgattgctactctt
cttgtgctacagttcatacgctgtgcaaaggaactgcaagggatagtcttcaaatcactg
atgaaactggataatttaacaacttcaagcggtgttcactgggcttttgagtccatcaag
aaagcaacagagtgggtaaaaagagttgagggacaatttgcatctatttgctatcgactc
gaacttgggaaagactgggattctgccaccaagaagatactggggatcgagtgcaactaa

KEGG   Meleagris gallopavo (turkey): 100551477
Entry
100551477         CDS       T01523                                 

Gene name
PARP3
Definition
(RefSeq) LOW QUALITY PROTEIN: protein mono-ADP-ribosyltransferase PARP3
  KO
K10798  poly [ADP-ribose] polymerase 2/3/4 [EC:2.4.2.30]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03410  Base excision repair
mgp04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    100551477 (PARP3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100551477 (PARP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mgp03032]
    100551477 (PARP3)
   03036 Chromosome and associated proteins [BR:mgp03036]
    100551477 (PARP3)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100551477 (PARP3)
Enzymes [BR:mgp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     100551477 (PARP3)
DNA replication proteins [BR:mgp03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     100551477 (PARP3)
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    100551477 (PARP3)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     100551477 (PARP3)
SSDB
Motif
Pfam: PARP PARP_reg WGR
Other DBs
NCBI-GeneID: 100551477
NCBI-ProteinID: XP_010716676
Ensembl: ENSMGAG00000003932
LinkDB
Position
14
AA seq 527 aa
MAPKRRAPPASQPADGGKKAXGGQEEEEDAWSSALTALKAAPKEKPPATIDGQCPLSAGP
DAQVYEDYDCTLNQTNIKANNNKFYIIQLIMHDGTYSTWNRWGRVGEVGQSKLLPFTSLE
AAKKDFEKKFWEKTKNSWAARENFVAQPGKYTLIEVQPGAGQEVTLRADGVGDEKVSKCR
TLPCALDETTQKLVALIFSSDMFRHAMQTMNIDVKKMPLGNLSKQQIARGFEALEELEAA
LGEQPCRMSRLEELSSRFYTIVPHNFGRARPPPIDSPELLRAKKDMLLVLADIEVAQSLQ
AQKVEEEEEVVAHPLDRDYALLCCQLTLLEHTSQEYEMILNYVAQTGGQVYILNIWKVAR
EGEDKLFQAHDHLEHRRLLWHGTNVAVVAAILRNGLRIMPHSGGRVGKGIYFASENSKSA
GYVGCTSKRVGLMFLTEVALGKQYCITRDEPTLQQPPDGYDSVLACGRTEPDPAQDVEVM
LDGKKVLVCQGKPIPMPAYKDSSFFQSEYLIYQESQCRIRYLVQLRF
NT seq 1584 nt   +upstreamnt  +downstreamnt
atggcccccaagcgccgagcaccccctgcatcccagcccgctgatgggggcaagaaagcc
naaggggggcaggaggaggaggaggatgcctggagctcggcgctcactgccttgaaggca
gcccccaaggagaagccccccgccaccattgatgggcagtgtcccctgagtgcagggcct
gatgcacaggtctatgaggactatgactgcaccctgaaccagaccaacatcaaagccaac
aacaacaagttctacattatccagcttatcatgcatgatggtacctacagcacctggaac
cgctggggacgtgtgggagaagtgggccagtccaagctcctgccattcacctctctggaa
gctgccaagaaggattttgagaaaaagttttgggaaaagaccaagaacagctgggcagca
cgggagaacttcgtggcccagccaggaaagtacaccttgatcgaggtgcagcccggcgcc
gggcaggaggtgaccctcagggcggatggtgtgggtgatgagaaggtctccaagtgccgc
acgctgccttgtgccttggatgagaccacgcagaagctggtggccctcatcttcagcagc
gacatgttccgccacgccatgcagaccatgaatattgatgtgaagaagatgccactgggg
aacctgagcaagcagcagattgctcggggcttcgaggcactggaggagctggaggcagca
ctgggggagcaaccctgcaggatgtcccggctggaggagctctcctcacgcttctacacc
attgtgccccacaactttgggcgggcacggccaccccccattgattctcccgagctgctg
cgtgccaagaaagacatgctgctggtgctggctgacatcgaggtggcacagagtctgcag
gcacagaaggtggaggaggaggaggaggtggtcgcccaccccctggaccgggactacgcc
ctgctgtgctgccagctcaccctgctggagcacacctcccaagagtatgagatgatcctg
aactatgtggcacagacagggggccaggtctacatcctcaacatctggaaggtggcccga
gagggtgaggacaagctcttccaggcccatgaccacctggagcaccggcgcctgctgtgg
cacggcaccaacgtggcagtggtcgcggccatcctgaggaatgggctgcgcatcatgccc
cactcagggggacgcgtgggcaagggcatctactttgcctctgagaacagcaagtctgct
ggctacgtgggctgcacatccaagcgagttggcttgatgttcctgacggaggtggctctg
ggcaaacagtactgcatcacccgcgatgagcccacgctgcagcagccgcccgatggctat
gacagcgtcctggcctgtgggcgcacggagccagaccctgcacaggatgtggaggtgatg
ctggatgggaagaaggtgctggtgtgccaaggcaagccgatccccatgcccgcctacaag
gactcatccttcttccaaagcgagtacctcatctaccaggagagccagtgcaggatccgc
tatctcgtccagctccgcttctga

KEGG   Meleagris gallopavo (turkey): 104917598
Entry
104917598         CDS       T01523                                 

Definition
(RefSeq) protein mono-ADP-ribosyltransferase PARP4-like
  KO
K10798  poly [ADP-ribose] polymerase 2/3/4 [EC:2.4.2.30]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03410  Base excision repair
mgp04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    104917598
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104917598
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mgp03032]
    104917598
   03036 Chromosome and associated proteins [BR:mgp03036]
    104917598
   03400 DNA repair and recombination proteins [BR:mgp03400]
    104917598
Enzymes [BR:mgp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     104917598
DNA replication proteins [BR:mgp03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     104917598
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    104917598
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     104917598
SSDB
Motif
Pfam: PARP PARP_reg
Other DBs
NCBI-GeneID: 104917598
NCBI-ProteinID: XP_010727343
LinkDB
Position
1
AA seq 561 aa
MVRKTCHLLKIKLPQIKMKAMIPILLLVGESDKRIEFEVGTLRFYSENAPFFPQDFEVAK
YNVLEKINSKGSKDFVVIELHCSQEQSEFLFRLYAHFSASNGTKKNKQFLINKTAEEIRE
NYDILVANLKSQDFLLRETFPPEAECLASTELQKLLLEESINSSTVCQQVSDFVELIWAE
ALGHLDSLLLESVNNISLNDVSKAEGILLQVKNALNEGADEAALQEMMMEFYQLIRHKTE
IDYEVSKRLLSTKQDLCQLMRDMLNVRETSISCPNPSSLAKYQALRCKIDAIGPISDEFL
NVERQVLKNNYNGCSVRILQVYRIGRVSETAEFMSSLGNVRSLFHASSVRNFMGILSRGL
LMPKVVVEDHGVERTDTGNLGSGIYFSDSVSASIKYSSPSEMDGTRLLAVCDVALGSCLD
LYERDFSLTAAPSGYNSVHGVRKTAGISSDFEDDEFVVYKTTQVKIRYVVKFCLAEDEIK
LFQPGIGVETEQDNTELESQCHSQNESYELPSANISNTVKTGLQDRLGNPIPLESVHIKA
RIIDFVAQVKYAMHCLFPCQT
NT seq 1686 nt   +upstreamnt  +downstreamnt
atggttcggaagacttgtcatcttctgaaaataaaattgccacaaatcaaaatgaaagca
atgataccaatcttactgttagtaggagaaagtgacaagagaattgaattcgaagtgggg
actctcagattttacagtgaaaatgctcctttttttcctcaagattttgaagttgcaaaa
tacaatgtccttgaaaaaattaattccaagggaagcaaggattttgtagttattgagtta
cattgttctcaagaacagtctgagtttctatttcgattatatgcacacttcagtgcttca
aatggaaccaagaaaaataaacaattcctaataaataagactgctgaagaaataagagaa
aattatgatattcttgttgcaaacctgaagagccaggatttcctgctcagagaaactttt
ccaccagaagcagaatgtttagcttctacagaattacaaaagttacttttagaagaatcc
atcaattcaagtactgtatgtcaacaagttagtgattttgtggagttgatctgggcagaa
gctcttggccacctggatagtctactacttgaatcagtgaacaacatcagcctaaatgat
gtgagcaaagcagaaggtattttgcttcaggtaaagaatgcactcaatgagggagctgat
gaggcagcactgcaagagatgatgatggaattctatcaacttatacgtcacaaaactgaa
atagactatgaagtttccaaaaggctgttatctacaaaacaggacctgtgccagctcatg
cgagacatgcttaatgtacgggaaacaagtatatcatgcccaaacccatcatctctggcc
aagtaccaggccctgaggtgcaagattgatgccattggtccaataagtgatgaatttctc
aatgttgaacgacaagtgttgaaaaacaattataatggctgttcagtgagaattttacaa
gtatataggattggcagagtaagtgaaacagcagaatttatgagcagtcttggaaatgtt
cgatctttattccatgcatcatctgtaaggaatttcatgggaattctttccagaggactc
ctaatgccaaaagtggttgttgaagatcatggtgtggaaagaactgacactgggaatctg
ggaagtggcatttacttcagtgattctgtcagtgccagtattaagtattcttcacccagt
gaaatggatggaacccgactcctggcagtttgtgatgtggcacttggatcctgcttagat
ttgtatgaacgagatttttcattaactgctgccccatcaggttacaacagcgtgcacgga
gtccgcaaaacagcaggcatctcttcagactttgaggatgatgaatttgttgtgtataaa
accacacaggttaaaattagatatgttgttaagttttgccttgctgaagatgaaataaaa
ctgttccagcctggaattggggtggaaactgagcaagataacactgagttggaatcacag
tgtcattcacagaatgagagctatgaattacccagtgcaaatatttcaaatacagtgaaa
actggtcttcaagacagactgggaaatcccattcctctggaaagtgttcatatcaaggca
aggataatagactttgtagcacaggtaaagtatgctatgcattgtctctttccatgtcag
acctga

DBGET integrated database retrieval system