KEGG   Meleagris gallopavo (turkey): 100543308
Entry
100543308         CDS       T01523                                 

Gene name
MLH3
Definition
(RefSeq) DNA mismatch repair protein Mlh3 isoform X2
  KO
K08739  DNA mismatch repair protein MLH3
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    100543308 (MLH3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100543308 (MLH3)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     100543308 (MLH3)
SSDB
Motif
Pfam: DNA_mis_repair MutL_C HATPase_c_3 HATPase_c DUF6157
Other DBs
NCBI-GeneID: 100543308
NCBI-ProteinID: XP_010710037
Ensembl: ENSMGAG00000012735
LinkDB
Position
5
AA seq 1404 aa
MIKHLAEDVQARLRSGVAVTSLGQCVEELVFNSIDAKATCVAVRVDLEAFKIQVVDNGSG
MGREDLSKMGKRYFTSKCSSVADLEKLTFYGFRGEALASIANMASVVEVSSKSSKTAKTF
VKLFHNGHALEVCEAELSRPSGGTTVTVCNLFHQLPVRRRCMDPVLEFERVRQKVEAISL
MHPSVSLSLRNDISCSMVLQLPKTRDVYSRFCQIYGLGRSQKLREIKHKSGGFEISGYIS
TEGHYNKNMQFLYVNRRLVLKTRLHKLIDFLLRKESVICKAKSVPVSRQGSSSPGRLRCG
PELYGIFVLNVTCAYSEYDVSLEPAKTLIEFQNWDVLLACVEEGVKMFLKREHLFVEPCC
EDIREFNEDNNFCLHNAPVTKSTLPEDKSIQENFKKACDEIIDSYEVCKLQSKDVKRKSM
VGKKSSNPTESNKNTQETEISSNQKIAELSGQCRNKKAEIPLSKKDDTTSNFIISDMLEQ
EPKDTISSQKLCDTHLKSSENLHSSLTEGARSEIMKKDDCDDLRRGAENCAKDVGNQQDK
VVQKSNTVCISNNGFIQWRSEREDPTETAGESETIYGSSLIRLHHVREGDREATEVIDNA
GRRTVGSVPEKVHSHLGLKRCVVQNEPPREHKQTETNLALNMHYRACPVSAKHTSMHKVS
LPIQSLNAKYISSNVNKEYIPLCSREVGMADGNEQSENRSLPSQARDGRDMSTATSKRHY
ETSTVSDLPLATSSDIPHSKAVKSPRRQIAEPRSQPCKKLSLSTQLGSLEKFRRYYGRVK
CTPPTPLPEQSEFCLPVLNAQANCDFSRSQNNSHGRLSICETPTLDSNNNSHVLKSLDEV
LLCSGKTSLDRQDLCHSPLTLSDYSEVSKKNTSSQRSPGSLSSKLCQMKTDHQAVKQLGE
QLQTDSSRKDNHSFDLESSNNDFLYNPCQRYKSSVEEMRDGFSISKGDACPQSDDLRSES
MKCTVSLSPLSSTEGEYTISASSVLPFPAKKDGFDIICEDESMLDESSKQNVKDPEVHCT
TFPSNLAFSGDNASTGDPRDDLRNSDWLQDFDALLGKTVYINKTTGLSTYNTPPEEFPAA
CIKDLTTMAVNVVSENGSEGESLQSMLSEWDNPVFVRCPEIAVDVTNGQAENLAVKIHNI
LYPYRFTKDMIHSMQVLQQVDNKFIACVINTRNEMDKKEGGNLLVLVDQHAAHERIRLEQ
LIADSYEKEAAACGKKKFLSSSVSPPLEIEVTEEQRRILWCCYKNLKDLGLELSFPEINN
LILVKKVPLCFTEREANELRRKRQPVNKSIVEEFIKEQVELVQTTGGARGTMPLTFLKVL
ASQACHGAIKFNDSLTSEESCRLMEALSSCQLPFQCAHGRPSMMPLADIDHLQQEMQPKP
NLARLRKMVRAWQLFGNRDPNQKR
NT seq 4215 nt   +upstreamnt  +downstreamnt
atgatcaagcacttggcagaagacgtgcaagccaggctgcgctctggagtggcggtcacc
tcgctggggcagtgtgttgaggagcttgtcttcaacagcatcgatgccaaagcaacgtgt
gtagctgttagggtggatttggaagcttttaagatccaggtggtggataatggctccggc
atggggagagaggacttaagtaaaatgggaaagcggtacttcactagtaagtgcagctca
gtggcagacttagagaagctgacgttctacggctttagaggagaggcgctggcaagcata
gcaaacatggccagtgttgtggaagtttcatctaagagcagcaagacagcaaaaactttt
gtgaaactgtttcacaatgggcatgcactagaagtctgtgaagctgaattgagcaggcca
agtggcggaacgacagtgaccgtgtgtaatctgttccatcagttaccagtgaggaggagg
tgcatggatcctgtgctggaatttgagagggtgaggcagaaagtagaggctatatcgttg
atgcatccctctgtttcactttctttaaggaatgatatttcttgttctatggtgcttcag
ctccctaagacaagagatgtttactctcgtttttgtcaaatatatggactgggcagatct
cagaagttaagagaaataaagcataagtctgggggatttgagataagcggttacatcagt
actgaaggacattacaataagaatatgcaattcttgtatgtcaatagaaggcttgtttta
aagacaagactacataaactgattgactttttattaagaaaagaaagtgtcatttgtaag
gcaaaaagtgtccctgtgagcagacagggttcctcaagtcctggtcgccttcgctgtggc
ccagagctgtatgggatctttgttctcaatgtgacctgtgcgtacagtgaatacgatgtg
tctctagaacctgcaaaaactctgattgagttccagaactgggatgttcttctagcttgt
gtagaggaaggagtgaaaatgtttttgaaaagagaacatttatttgtcgaaccttgttgt
gaggacatcagagagtttaatgaggataataatttttgtttgcataatgctccagttaca
aaatccacactccctgaggataagagcatccaagaaaactttaagaaagcatgtgatgaa
attatagattcctatgaagtgtgtaaattgcaatcaaaagatgtcaaaagaaaatccatg
gtgggaaaaaaatcttcaaatcctacagagtcaaataaaaatacacaggaaactgaaatt
tcctcaaatcagaagattgctgaactctctggtcaatgtagaaacaaaaaagcagagatt
ccactgtccaagaaagatgacaccacatctaatttcattatatctgatatgttggaacag
gagccaaaagacacaatcagttcccaaaaactgtgtgatactcatctgaaatcttcagaa
aatctccattcctctttgactgaaggagccagatcagaaataatgaaaaaagatgattgt
gatgacttgcggcgtggtgctgagaattgtgcaaaagatgtaggaaaccagcaagacaaa
gttgtgcagaaaagcaacacggtttgtatctcaaacaatggttttattcagtggcgatct
gagagagaagaccctactgaaacagcaggggaatctgaaactatatatggaagttcattg
ataagactacatcatgtaagagaaggagacagggaagcaactgaagtaatagataatgct
ggaagacggactgttggttcagtaccagaaaaagtgcattctcacttaggcctcaaaaga
tgtgtcgtgcaaaatgagccaccccgtgaacataaacaaacagaaacaaatcttgcatta
aacatgcactatagagcttgccctgtcagtgccaagcacacttccatgcacaaagtgagt
ttgccaattcagtctttaaatgctaagtatatttccagtaatgtgaataaagaatatata
cctctctgcagcagagaagtaggcatggctgatggaaatgagcagtcggagaatagaagt
ttgccaagtcaagcacgtgatgggagagacatgtccactgccaccagtaaaagacattat
gaaacatcaactgtgtcagacttgccgctggcaacatcttcagatattcctcacagtaaa
gccgtaaaaagtcctagaagacaaatagctgagccaagatcacagccttgcaagaagctg
agcctatctacgcagctgggttcattagaaaagttcaggagatattatgggcgtgtcaag
tgtacgccaccaacaccattaccagagcagagtgaattttgtctcccagttcttaatgca
caagctaattgtgacttttcaaggagtcagaataacagtcatggtcgcttgagcatttgt
gagactccaactttggattctaataataatagccatgttttgaaatctttggatgaagtt
ttactctgcagtggaaaaacttcactggacagacaagacctttgtcacagccctttgacg
ttgtctgattactcagaggttagtaaaaaaaacacgagtagtcaaagatctccaggatcc
ttatcatccaagctgtgccaaatgaaaactgatcaccaagcagtaaaacagctgggtgaa
caactccaaacagattcaagtagaaaagataaccactcttttgatcttgaatcttcaaat
aatgattttttgtataacccttgtcaaagatataaatcttcagtggaagaaatgagggat
ggtttcagcatttctaagggggatgcttgtccacaatcagatgatttgagatcagaatcc
atgaaatgtaccgttagcctatcaccactcagcagcactgaaggagagtacacaatctct
gcaagcagcgttttaccatttccagcaaaaaaagatggctttgacatcatctgtgaagat
gaaagtatgttagatgaatcatcaaaacaaaatgtgaaagatcctgaggttcactgcacg
accttcccaagtaacttggcattctctggagataatgcaagtacaggtgatcccagagat
gatttgcgtaattcagattggctgcaagattttgatgctttattgggtaagacagtctac
atcaataaaacaacgggactgagcacctacaacactcctcctgaagagtttccagctgcc
tgcattaaagatttaacaacaatggctgtgaatgttgtctcagagaatggcagtgaaggc
gagtctctgcagtccatgctttcagaatgggataatcctgtttttgttcgctgcccagag
atagctgttgatgtgaccaacggtcaggctgagaatcttgctgtgaaaattcataatatt
ttgtatccttatcgttttaccaaagacatgattcattcaatgcaggttcttcagcaagtg
gacaataaattcattgcttgtgtaatcaacaccaggaatgaaatggataaaaaggaaggt
ggaaacctcttggttttggtggaccaacatgcagctcatgaacgaattcgcctggagcag
cttattgcagattcctatgagaaggaagctgccgcatgtggcaagaagaaatttctgtct
tcctctgtctctccccctttagaaattgaagttacagaagagcaaagaagaattctatgg
tgctgctacaaaaatttgaaggatctgggccttgaattatcatttcctgagatcaacaac
ttgattctagtgaagaaagtgccactgtgttttacagaaagagaggccaatgaactacga
cggaaaagacaacctgtcaataaaagcattgtggaggagtttattaaagaacaagttgag
ctagtgcagaccacgggaggagcacgagggacaatgcctctgacatttctgaaggtgtta
gcttcccaagcctgtcacggagctattaagtttaatgacagtttgacttcagaagagagc
tgtcggctcatggaagctttgtcatcttgccagctgcccttccaatgtgctcatggaaga
ccttccatgatgccccttgcagacattgaccatctacagcaggaaatgcagcctaaacct
aatttggctagactgcggaaaatggtgcgagcatggcaactgtttggaaacagagaccct
aaccaaaaaaggtaa

DBGET integrated database retrieval system