KEGG   Meleagris gallopavo (turkey): 100543522
Entry
100543522         CDS       T01523                                 

Gene name
XRCC5
Definition
(RefSeq) LOW QUALITY PROTEIN: X-ray repair cross-complementing protein 5
  KO
K10885  ATP-dependent DNA helicase 2 subunit 2
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    100543522 (XRCC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100543522 (XRCC5)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA-PK complex
     100543522 (XRCC5)
SSDB
Motif
Pfam: Ku_N Ku Ku_PK_bind Ku_C VWA
Other DBs
NCBI-GeneID: 100543522
NCBI-ProteinID: XP_010711901
Ensembl: ENSMGAG00000011667
LinkDB
Position
7
AA seq 773 aa
MAPRPAPPRLFPQPRSRSPCRWVALPGLQAPVGALSAAHRGADKMARGGKSAIVLCLDVG
TTMSSSAPGEESPLEQAKRVMTKFLQRQVFAESKDEVAVVLFGTDGTKNNLASRDQYQNI
TVHRSLMLPDFDLLEDIQNMIQLGTQQADFLDAIIVCMDLLQQETLGKKFEKRHIELFTD
LSSPVSEDQLEIIIANLKKTGTSLQFFLPFPVDGADGRGDASASIFSQLHQNSFPRKRLT
AQQKEGIDVVKKLMHTLDEEGGLEEIYTFRESLERLAMFKKIERRSAPWSCQLTIGSNLS
IRIVAYKALTEEKVKKIWTVVDAKTLRKEDVQRETVYCLNDDDETEVQKDDTIQGFRYGS
DIVPFSKEDEEQMKYKTEAKCFSVLGFSRSSQIQRHCYMGNHVLKVFAAKDDENAAVAFS
AFVQALDELNVVAIVRYAYDRRCNPQIGVAFPCIKDAYECLFYVQLPFMEDVRQYVFSSL
KNNKKCSPTVDQLSAIDSLIDSMNLVYEDDDGETFEDLFKPSKIPNPHFQRLYQCLQHKA
FHPNEPLPPIEQHLLEMLEMPCVVKERCKAPVEKVKALFPLKDAGKKKEEKTAQDIFKDD
EDGPNAKRRKTEDEEDSFSIMKLAEGNVTSVGSVNPAEDFQILVRQKNADFKDVSQQLIN
RIDQFLENRSSQYYMKGINCIKVFRGEAMKLSKVQCFNDFLQALKSKVEDKALADFWEIV
VQDRISLITKDEAEGSSVTSEEAEKFLTPKEKKNETLPATDEGGDVDDLLDMM
NT seq 2322 nt   +upstreamnt  +downstreamnt
atggcgccccgccccgccccgcctcgcctcttccctcagcctcgctcgcgctctccctgc
cgctgggtggcgctgcctggactccaggcgccagtcggtgcgctgagcgcggcgcaccgc
ggtgctgacaagatggcgcgcggcggcaagtcagccatagtgctgtgcctggacgtaggc
accacaatgagcagttctgctcctggggaggagtctccgctggaacaagccaagagggtt
atgaccaagtttctgcagcgacaggtttttgctgagagtaaagatgaagttgctgtagtt
ttgtttggcacagatggcactaagaataacctcgccagtagggatcaataccaaaatatc
actgtacacaggtctctaatgctgccagattttgacttgctagaagatattcaaaatatg
attcagctaggcactcaacaagcagactttctggatgcaattattgtgtgtatggacttg
cttcagcaggaaacattaggaaagaaatttgagaagagacatattgaactgtttacagac
cttagtagtcctgtcagtgaggatcagctggaaattatcattgctaacttgaagaaaaca
ggaacttcgctccaattttttttaccatttccagtggatggtgctgatggacgtggagat
gcaagtgccagcatattctcgcagttgcaccaaaactcattcccaagaaagagattaact
gcgcagcaaaaggaaggcattgatgtggtgaagaagttgatgcatactttggatgaagaa
ggagggctggaagaaatttacactttcagagagagcctggaacgtcttgcaatgtttaag
aaaattgaaagaagatctgcaccttggtcatgccagttaactattggttccaatttgtct
ataaggattgtggcctacaaagcactcacagaagagaaggtgaaaaaaatttggacagtt
gtggatgctaaaaccctcagaaaagaagatgtgcagagagaaaccgtttactgtttaaat
gatgatgatgagacagaggttcaaaaagatgatactattcaagggtttcgctatgggagt
gatatagttcctttttccaaagaagatgaagagcaaatgaaatacaaaactgaagcaaaa
tgtttttctgtcctgggattcagcagatcatctcagatccagaggcactgttacatgggc
aaccacgttctcaaggtctttgcagcgaaagatgatgagaatgcagcagttgctttttct
gcctttgttcaagcattggatgagttgaatgtagtagctatagtgcgttatgcttatgat
agaagatgtaacccacaaattggggtagcttttccatgcatcaaggatgcgtatgagtgt
ctcttctatgtgcaactaccattcatggaagatgtaagacagtacgtgttttcatccctg
aaaaacaataagaaatgctctcctactgtggatcagttatctgcgattgactccttgatt
gattctatgaatttggtttatgaagatgatgatggagaaacttttgaggacctgtttaag
cccagcaaaatcccaaaccctcattttcaaaggttatatcagtgtttgcagcataaggct
tttcaccctaatgagccattgccaccaattgaacaacaccttttggaaatgctggagatg
ccctgtgtggtaaaagaaaggtgcaaggctccagttgaaaaagtaaaggcactttttcct
ctaaaagatgctggcaagaaaaaagaagagaagactgctcaagatatctttaaagatgat
gaagatggacccaatgctaagagaagaaaaactgaagatgaggaagatagctttagcatc
atgaaacttgctgaaggcaatgtcacctctgttggcagtgttaacccagcagaagacttc
caaattctggtgaggcagaaaaatgctgacttcaaagatgtgagtcagcagctgataaac
cgcattgatcagtttctggaaaacagaagctcacagtactacatgaaagggatcaattgt
attaaagttttcagaggggaggctatgaagctatccaaggtgcagtgctttaatgatttt
ctgcaggccttgaagtcaaaggtggaagataaagccttagctgatttctgggagattgtg
gtacaagacagaatttctttgatcactaaagatgaagcagagggaagttctgtgactagt
gaagaagctgaaaagttcttgactccaaaagaaaagaaaaatgaaactctgcctgccaca
gatgaaggtggtgatgttgatgatttgctggacatgatgtga

DBGET integrated database retrieval system