KEGG   Meleagris gallopavo (turkey): 100543659
Entry
100543659         CDS       T01523                                 

Gene name
HMGB1
Definition
(RefSeq) high mobility group protein B1
  KO
K10802  high mobility group protein B1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03410  Base excision repair
mgp04140  Autophagy - animal
mgp04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    100543659 (HMGB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100543659 (HMGB1)
  09143 Cell growth and death
   04217 Necroptosis
    100543659 (HMGB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mgp03036]
    100543659 (HMGB1)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100543659 (HMGB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mgp04147]
    100543659 (HMGB1)
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic type
  Nucleosome assembly factors
   HMG (high mobility group) proteins
    100543659 (HMGB1)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     100543659 (HMGB1)
   MMR (mismatch excision repair)
    Other MMR factors
     100543659 (HMGB1)
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100543659 (HMGB1)
SSDB
Motif
Pfam: HMG_box HMG_box_2 HMG_box_5
Other DBs
NCBI-GeneID: 100543659
NCBI-ProteinID: XP_003203448
Ensembl: ENSMGAG00000015087
LinkDB
Position
1
AA seq 215 aa
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSSKEKGKF
EDMAKADKLRYEKEMKNYVPPKGETKKKFKDPNAPKRPPSAFFLFCSEFRPKIKGEHPGL
SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKVDAGKKVVAKAEK
SKKKKEEEEDEDEDEEDEEDEEEEEEEEEDDDDDE
NT seq 648 nt   +upstreamnt  +downstreamnt
atgggcaaaggtgatcctaagaagccgagaggtaaaatgtcttcatacgccttctttgtg
caaacctgccgggaggagcacaagaagaaacatccagatgcttcagtgaacttctcagag
ttctcaaaaaaatgctcagaacgatggaagactatgtcttctaaggagaaagggaagttt
gaagatatggcaaaggctgacaagcttcgttacgaaaaagaaatgaaaaactatgtacca
cctaagggggaaacaaaaaagaagttcaaggatccaaatgcaccgaagaggcctccttcg
gcttttttcttgttttgctctgagtttcgtccaaaaatcaaaggagaacatcctggtctg
tccattggggacgtggcaaagaaactgggagagatgtggaacaacactgcagcagatgat
aaacagccttatgaaaagaaggctgctaagctgaaggagaagtatgagaaggatattgct
gcgtaccgggccaaagggaaggttgatgcaggcaaaaaagtagttgccaaggctgagaag
agcaagaagaagaaggaagaggaggaagatgaggacgaagacgaagaggatgaagaggat
gaagaagaggaagaagaggaggaggaagatgatgatgatgatgaataa

DBGET integrated database retrieval system