KEGG   Meleagris gallopavo (turkey): 100543753
Entry
100543753         CDS       T01523                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
mgp  Meleagris gallopavo (turkey)
SSDB
Motif
Pfam: MRAP FixQ DUF6709
Other DBs
NCBI-GeneID: 100543753
NCBI-ProteinID: XP_003202975
UniProt: A0A803YLD0
LinkDB
Position
1:complement(102483854..102495988)
AA seq 120 aa
MANRTNSSEYFWSYEYYWDYIDPIPVDGRKLKVNKYSIVIAFWVGLAAFVMFLFLILLYM
SRSGSNPVKQVVVRNRVEESSSNSEQPHCDNLSSPFPDLVAPGTPSCLPDDSSIHGSMSA
NT seq 363 nt   +upstreamnt  +downstreamnt
atggccaacagaacaaactcatctgagtacttctggtcttatgaatattactgggattac
atagatccaattccagtagatggaaggaagttgaaagttaataaatattctattgtcata
gccttttgggttggacttgctgcctttgtgatgtttcttttccttattttgctctacatg
tcccgctctggctcaaatccagttaaacaggtggtcgtaaggaaccgggtagaagaaagc
agttccaacagcgagcagcctcactgtgacaatctcagcagtccattcccagatttggtt
gctcctggaacacccagctgccttccagatgacagtagcattcatggaagtatgtcagcc
tga

DBGET integrated database retrieval system