KEGG   Meleagris gallopavo (turkey): 100544808
Entry
100544808         CDS       T01523                                 

Gene name
FEN1
Definition
(RefSeq) flap endonuclease 1
  KO
K04799  flap endonuclease-1 [EC:3.-.-.-]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03030  DNA replication
mgp03410  Base excision repair
mgp03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100544808 (FEN1)
   03410 Base excision repair
    100544808 (FEN1)
   03450 Non-homologous end-joining
    100544808 (FEN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mgp03032]
    100544808 (FEN1)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100544808 (FEN1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mgp04147]
    100544808 (FEN1)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.-  
   3.-.-  
    3.-.-.-  
     100544808 (FEN1)
DNA replication proteins [BR:mgp03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    100544808 (FEN1)
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     100544808 (FEN1)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100544808 (FEN1)
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100544808 (FEN1)
SSDB
Motif
Pfam: XPG_N XPG_I 5_3_exonuc HHH_5
Other DBs
NCBI-GeneID: 100544808
NCBI-ProteinID: XP_003206199
Ensembl: ENSMGAG00000015781
UniProt: G1NRM5
LinkDB
Position
5
AA seq 381 aa
MGIHGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGAEVLQNEEGET
TSHLMGMFYRTIRMVENGIKPVYVFDGKPPQLKSGELARRTERRSEAEKHLQEAQEAGEE
TNIEKFSKRLVKVTQQHTDECKKLLMLMGIPYVEAPGEAEASCATLVKAGKVYAAATEDM
DCLTFGSPVLMRHLTASETKKLPIQEFHLNRILQDLGLTWEQFVDLCILLGCDYCESIRG
IGPKRAVELIKQHKTIEEIIQHIDTKKYPLPENWLHKEAQKLFLEPDVVNPDDVELKWTE
PNEEELVQFMCGEKQFNEERIRNGVKRLSKSRQGSTQGRLDDFFKVTGSITSAKRKEPES
KGSAKKKAKTNSATAKFKKGK
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgggaatccacggcttggccaagctgattgccgatgtggcgcccagcgccatccgggag
aacgacatcaagtcgtactttgggcggaaggtggccattgatgcctccatgagcatctac
cagttcctcatagctgtgcggcagggtgccgaagtgctgcagaacgaggagggtgagacc
accagtcacctaatgggcatgttctaccgcaccatccgcatggtggagaatggcatcaag
cctgtctatgtgtttgatggcaaaccaccacagctcaagtccggggagttggccaggagg
acggagcgccgctctgaggccgagaagcacctgcaggaggctcaggaggctggcgaggag
accaacattgagaagttcagcaagaggttggtgaaagtgacacagcagcacaccgacgag
tgcaagaagctgttgatgttgatgggcatcccctatgtggaggcgccaggggaggcggaa
gccagctgtgctacactggtgaaggcagggaaggtgtatgcagctgctacggaggacatg
gattgcttgacctttgggagccctgtgctgatgaggcacctcactgccagtgagacaaag
aagctgcccatccaagagttccacctgaaccggatcctgcaggacctgggcctgacctgg
gaacagtttgtggatctgtgcatcctcttgggctgtgactactgtgagagcatccgcggc
atcgggccgaagcgggcggttgagctcatcaagcagcacaaaaccattgaggagatcatc
cagcacatcgacaccaagaagtaccccttgcctgagaactggttgcataaagaggcccag
aagctctttctagagcctgacgttgtcaaccctgatgacgttgagctgaagtggacagag
cccaatgaggaggagctcgtgcaattcatgtgtggggagaagcagttcaatgaggagcgc
atccgcaatggggtcaagaggctgagtaagagccgccagggcagcacacagggccggctg
gatgacttcttcaaggtgacgggctccatcacatcggccaaacgcaaggagcctgaaagc
aaggggtcagcgaagaagaaagccaagaccaacagtgccacagccaagttcaaaaagggg
aaataa

DBGET integrated database retrieval system