KEGG   Meleagris gallopavo (turkey): 100545227
Entry
100545227         CDS       T01523                                 

Gene name
MBD4
Definition
(RefSeq) methyl-CpG-binding domain protein 4
  KO
K10801  methyl-CpG-binding domain protein 4 [EC:3.2.2.-]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    100545227 (MBD4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mgp03036]
    100545227 (MBD4)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100545227 (MBD4)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     100545227 (MBD4)
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic type
  Heterochromatin formation proteins
   MBPs (metylated DNA binding proteins)
    100545227 (MBD4)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     100545227 (MBD4)
SSDB
Motif
Pfam: HhH-GPD
Other DBs
NCBI-GeneID: 100545227
NCBI-ProteinID: XP_010717079
Ensembl: ENSMGAG00000010259
LinkDB
Position
14
AA seq 206 aa
MDADGLRPADDGSFTAVKIQRGEPVPRTQVDRRKTSPYFSSKYSKEAPSPPRRKAFRKWT
PPRSPFNLVQETLFHDPWKLLIATIFLNKTSGKMAIPVLWEFLRKYPSPEIARTADWKEM
SELLRPLGLYALRAKTIIKFSDEYLNKQWKYPIELHGIGKYGNDSYRIFCVNEWKEVRSA
AVQPQDHKLNIYHTWLWENHEKLSVD
NT seq 621 nt   +upstreamnt  +downstreamnt
atggatgccgacggcttgcggcctgctgacgacgggagcttcacggcagttaaaatacag
cgaggagaacctgtcccacggacacaagtggataggaggaaaacgagtccgtatttttca
agtaaatacagtaaagaagctcccagcccgcctaggaggaaggccttcagaaaatggact
cctccacgttccccttttaatttggtccaagaaacacttttccatgatccgtggaaactt
ctcattgcgaccatatttctcaataagacttcaggtaaaatggcaattcctgtgctctgg
gagttcctcaggaagtacccttcccctgaaatagccagaactgcagactggaaggaaatg
tcggagctgctcagacctctcggcctctatgcactcagagcaaaaactataatcaagttt
tcagatgagtacctgaacaagcagtggaagtaccccattgagctgcacggaattggaaag
tacgggaatgactcctacagaatcttctgcgttaatgaatggaaagaggtgcgcagtgct
gctgtgcagcctcaggaccacaagttgaacatctaccacacgtggctctgggaaaaccat
gagaagctgagcgtggactga

DBGET integrated database retrieval system