Meleagris gallopavo (turkey): 100546538 Help Entry 100546538         CDS       T01523                                  Name (RefSeq) MICOS complex subunit MIC19-like   KO K17563   MICOS complex subunit MIC19 Organism mgp  Meleagris gallopavo (turkey) Brite KEGG Orthology (KO) [BR:mgp00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mgp01009]     100546538   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:mgp03029]     100546538 Protein phosphatases and associated proteins [BR:mgp01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      100546538 Mitochondrial biogenesis [BR:mgp03029]  Mitochondrial protein import machinery   Inner mambrane    MICOS complex     100546538 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MIC19_MIC25 Motif Other DBs NCBI-GeneID:  100546538 NCBI-ProteinID:  XP_010708657 UniProt:  G1MXF6 LinkDB All DBs Position 1:2004222..2033644 Genome browser AA seq 87 aa AA seqDB search MGASGSTRRVTFEADENENITVVKGVRLSDSVIDRMKEPSSPTGRPQSQRRSPGAVNDEE LKKRIAEELALERARRETEAQKRRFVC NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgggcgccagcggcagcactcggcgtgtcaccttcgaggcggacgagaatgagaacatc acagtggtgaagggcgtgcggctatctgatagcgtcattgatcggatgaaggaaccttct tcgcccactggaagaccgcagtctcagcgccgatcacctggtgcagttaatgatgaagaa ctaaagaaaagaattgcagaagaattggcattagaacgagccaggagagagactgaagct caaaagagaaggtttgtttgttaa

DBGET integrated database retrieval system